KEGG   Xenopus laevis (African clawed frog): 379785Help
Entry
379785            CDS       T01010                                 

Gene name
cdk1-b, PSTAIR, cdc-2, cdc2, cdc2-b, cdc28a, cdc2a, cdc2x1.1, cdc2x1.2, p34cdc2, xcdc2
Definition
cyclin-dependent kinase 1 (EC:2.7.11.23 2.7.11.22)
Orthology
K02087  
cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Oocyte meiosis
p53 signaling pathway
Gap junction
Progesterone-mediated oocyte maturation
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    379785 (cdk1-b)
   04114 Oocyte meiosis
    379785 (cdk1-b)
   04115 p53 signaling pathway
    379785 (cdk1-b)
  Cell communication
   04540 Gap junction
    379785 (cdk1-b)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    379785 (cdk1-b)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    379785 (cdk1-b)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     379785 (cdk1-b)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     379785 (cdk1-b)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   379785 (cdk1-b)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   379785 (cdk1-b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 302 aa AA seqDB search
MDEYTKIEKIGEGTYGVVYKGRHKATGQVVAMKKIRLENEEEGVPSTAIREISLLKELQH
PNIVCLLDVLMQDSRLYLIFEFLSMDLKKYLDSIPSGQYIDTMLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDNKGVIKLADFGLARAFGIPVRVYTHEVVTLWYRASEVLLGSVR
YSTPVDVWSVGTIFAEIATKKPLFHGDSEIDQLFRIFRSLGTPNNEVWPEVESLQDYKNT
FPKWKGGSLSSNVKNIDEDGLDLLSKMLVYDPAKRISARKAMLHPYFDDLDKSSLPANQI
RN
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggacgagtacactaaaatagagaagattggagagggcacatatggggtcgtgtacaag
ggtcgtcacaaagcaaccggccaggtcgtcgcaatgaagaaaattagattggaaaatgaa
gaggaaggtgtcccaagtacagcaatccgagaaatatcactacttaaagagcttcagcac
cccaacatagtctgcctcctagatgtcctcatgcaagactcaaggttgtatcttatcttt
gagtttctctccatggatctaaagaagtatttagactcgatacccagcggccagtatatc
gatacaatgctcgttaagagttacctgtaccagatcctacaagggattgtattctgtcac
tccagacgagttctacacagagacctgaaacctcaaaacctgctcatagacaataaagga
gtgataaagttggcagattttggccttgccagagcttttggaattccggttcgggtttac
acacacgaggtcgtgacgttatggtacagagcctcggaagtgctgttggggtcagtccga
tattcaacgccagttgacgtctggagcgtaggaactattttcgccgagatcgccacaaag
aaacccctcttccacggtgactctgaaattgaccagctcttcaggatattcagatcttta
gggacacccaacaatgaagtgtggccagaagtagagtctttacaagattacaagaacaca
ttccccaaatggaaagggggaagcctgtcgtcgaatgtgaaaaatattgatgaggatggg
ctggacctgctgtctaaaatgctagtctatgatcccgccaagaggatttccgcacgaaaa
gctatgttgcacccctacttcgatgacttggataagtccagccttcccgccaatcagatt
agaaattaa

DBGET integrated database retrieval system