KEGG   Xenopus laevis (African clawed frog): 379789Help
Entry
379789            CDS       T01010                                 

Gene name
pdk4, 3j828
Definition
pyruvate dehydrogenase kinase, isozyme 4 (EC:2.7.11.2)
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     379789 (pdk4)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   379789 (pdk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 404 aa AA seqDB search
MKFARFLLKNAALANAPKQIERFSRFSPSPLSMKQFIDFGSANGCEKTSFGFLRQELPVR
LANIMRELYILPDQLLGTPSVQLVQSWYIQSLMELIEFVERDPEDQRVLSDFTEALVTIR
NRHNDVVPTMAQGVIEYKEAFGVDPVTNQNVQYFLDRFYMSRISIRMLINQHTLLFDGGT
NPAHPKHIGSIDPNSDVVEVVHDAFDTAKMLCEQYYLASPELRIKQANGKDPSQPIHIVY
VPSHLYHMLFELFKNAMRATIENHETSPRLPPIKVNVVLGSEDLTIKISDNGGGVPLRKI
ERLFSYMYSTAPRPLMDNSRNAPLAGFGYGLPISRLYARYFQGDLMLHSMEGFGTDAVIY
LKALSSESVERLPVFNKSAWKHYKFCTEADDWCIPSSEPKNLAR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgcccggttcctgctgaagaacgccgccttggcaaatgcacccaaacagatt
gagaggttcagccgcttctccccttccccgctttccatgaaacagttcatagactttggc
tctgccaatggctgtgagaagacatcctttgggttcctccgacaagagctaccagtaaga
ctggccaacatcatgagggagctctatatactccctgaccagttgctggggactccgtca
gtgcagcttgtccagagctggtacatacagagtttaatggagctaatagaatttgttgaa
agagatccagaagaccaaagagtgctgtccgatttcacagaggcccttgtgacaatccgg
aacagacacaacgatgtcgtccctacaatggctcagggagttattgaatacaaggaggca
tttggagtggatcctgtcaccaatcaaaacgttcagtattttcttgatcgcttttacatg
agccgcatttccatacggatgcttataaaccagcacactcttctttttgatggtggaacc
aacccagcccacccaaagcacattggaagcatcgatccaaactctgatgtggttgaggta
gtgcatgatgcttttgatactgccaagatgctttgtgaacagtactatttagcttctcct
gaactgagaataaagcaggcaaatggcaaagatccttcccagccgattcatatagtttat
gttccatcacatctctatcacatgctctttgagctttttaagaatgctatgcgggcaaca
attgaaaatcatgaaactagtccccgtctacctcctatcaaagtgaatgttgtcctagga
agtgaagatctaactattaagatatccgataatggaggaggcgttcccttgaggaagatt
gaacgactgttcagttacatgtattccacagcacccaggcctctgatggataattcacgg
aatgctcctttggctggttttgggtatgggttgcccatctctcgactttatgccaggtac
ttccagggtgacttaatgctgcattcaatggagggctttgggacagatgccgttatctat
ttaaaggcactatcatcggagtctgtagaaaggctaccagtcttcaacaagtctgcctgg
aaacattataaattctgcactgaagcagatgattggtgcattccgagtagcgaaccaaag
aacctggcaaggtag

DBGET integrated database retrieval system