KEGG   Xenopus laevis (African clawed frog): 379852Help
Entry
379852            CDS       T01010                                 

Gene name
g6pc
Definition
glucose-6-phosphatase, catalytic
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xla00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:xla00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xla00500]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:xla04068]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:xla04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:xla04920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 357 aa AA seqDB search
MENGMDALHDSGVQMIQYLQMNYKSSQDWFMFVSFAADLRNTFFIFFPIWFHLHEAVGIK
LIWVAVIGDWLNLVFKWILFGQRPYWWVHDTTYYGNSSAPVIEQFPVTCETGPGSPSGHA
MGSAGIYYVMVTAIITIMLKKKETSLSNWCMRGALWTGFWAVQVCVCLSRIFLAAHFPHQ
VVAGVISGMVVAEAFHHTQLIYKANLKKYIYTTLFLFSFALGFYLLLKSVGVDLLWTLEK
AKRWCAQPEWIHINTTPFAGLLRNLGIFFGLGLALNSKLYQESCRGKKGSQFTFRLCCIV
ASLLVLHLFDSFKPPTQVEMLFYALSFCKSAAVPLAAVGIIPYCVSQVLHQQNKKSL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggagaatgggatggatgctctccatgactctggagttcagatgatccaatatctccag
atgaactacaagagttctcaagactggttcatgtttgtttcatttgccgctgatctcaga
aacacttttttcatcttctttcccatctggttccatcttcatgaggcagttggcattaag
cttatttgggtggccgttattggggactggctgaatttagtttttaaatggattctcttt
ggacaaagaccatactggtgggttcatgacaccacttactatggaaactcatctgcacca
gtcattgaacagtttcctgtcacctgtgagaccgggccaggaagcccttcaggccatgcc
atgggctcagctggtatttactatgttatggtcacagccattatcacaataatgctaaag
aagaaggaaacatcactttcaaattggtgcatgcgcggagctctctggactggtttctgg
gccgttcaagtatgtgtctgcctgtctagaatctttcttgctgctcactttccccatcag
gtggtggctggagtgatctcaggaatggtggtcgctgaagcttttcatcacacgcagttg
atttataaggcgaacctaaagaaatacatctataccacactgtttctgttctcttttgct
ctgggcttctacttgctccttaaatctgtgggcgttgatctcctttggactctggaaaaa
gccaagagatggtgtgctcaacctgagtggatccatattaacaccacaccctttgctggt
cttctcagaaacctcggtattttctttggacttggactggctcttaactccaagctttat
caagaaagttgccgtggaaagaagggcagtcaatttactttccgcctctgttgcattgtt
gcctctttgcttgtgcttcacctttttgattcctttaagccaccaacccaagtggagatg
cttttctatgccctgtccttctgtaaaagtgctgctgtgcctcttgctgccgtgggaatt
attccttattgtgtttctcaggttctccaccaacaaaacaaaaaatcactttaa

DBGET integrated database retrieval system