KEGG   Xenopus laevis (African clawed frog): 379852Help
Entry
379852            CDS       T01010                                 

Gene name
g6pc
Definition
glucose-6-phosphatase, catalytic
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    379852 (g6pc)
   00052 Galactose metabolism
    379852 (g6pc)
   00500 Starch and sucrose metabolism
    379852 (g6pc)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    379852 (g6pc)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    379852 (g6pc)
   04920 Adipocytokine signaling pathway
    379852 (g6pc)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     379852 (g6pc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 357 aa AA seqDB search
MENGMDALHDSGVQMIQYLQMNYKSSQDWFMFVSFAADLRNTFFIFFPIWFHLHEAVGIK
LIWVAVIGDWLNLVFKWILFGQRPYWWVHDTTYYGNSSAPVIEQFPVTCETGPGSPSGHA
MGSAGIYYVMVTAIITIMLKKKETSLSNWCMRGALWTGFWAVQVCVCLSRIFLAAHFPHQ
VVAGVISGMVVAEAFHHTQLIYKANLKKYIYTTLFLFSFALGFYLLLKSVGVDLLWTLEK
AKRWCAQPEWIHINTTPFAGLLRNLGIFFGLGLALNSKLYQESCRGKKGSQFTFRLCCIV
ASLLVLHLFDSFKPPTQVEMLFYALSFCKSAAVPLAAVGIIPYCVSQVLHQQNKKSL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggagaatgggatggatgctctccatgactctggagttcagatgatccaatatctccag
atgaactacaagagttctcaagactggttcatgtttgtttcatttgccgctgatctcaga
aacacttttttcatcttctttcccatctggttccatcttcatgaggcagttggcattaag
cttatttgggtggccgttattggggactggctgaatttagtttttaaatggattctcttt
ggacaaagaccatactggtgggttcatgacaccacttactatggaaactcatctgcacca
gtcattgaacagtttcctgtcacctgtgagaccgggccaggaagcccttcaggccatgcc
atgggctcagctggtatttactatgttatggtcacagccattatcacaataatgctaaag
aagaaggaaacatcactttcaaattggtgcatgcgcggagctctctggactggtttctgg
gccgttcaagtatgtgtctgcctgtctagaatctttcttgctgctcactttccccatcag
gtggtggctggagtgatctcaggaatggtggtcgctgaagcttttcatcacacgcagttg
atttataaggcgaacctaaagaaatacatctataccacactgtttctgttctcttttgct
ctgggcttctacttgctccttaaatctgtgggcgttgatctcctttggactctggaaaaa
gccaagagatggtgtgctcaacctgagtggatccatattaacaccacaccctttgctggt
cttctcagaaacctcggtattttctttggacttggactggctcttaactccaagctttat
caagaaagttgccgtggaaagaagggcagtcaatttactttccgcctctgttgcattgtt
gcctctttgcttgtgcttcacctttttgattcctttaagccaccaacccaagtggagatg
cttttctatgccctgtccttctgtaaaagtgctgctgtgcctcttgctgccgtgggaatt
attccttattgtgtttctcaggttctccaccaacaaaacaaaaaatcactttaa

DBGET integrated database retrieval system