KEGG   Xenopus laevis (African clawed frog): 379876Help
Entry
379876            CDS       T01010                                 

Gene name
mapk8.L, jnk, jnk1, mapk8, sapk1
Definition
(RefSeq) mitogen-activated protein kinase 8 L homeolog
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04012  ErbB signaling pathway
xla04068  FoxO signaling pathway
xla04137  Mitophagy - animal
xla04140  Autophagy - animal
xla04141  Protein processing in endoplasmic reticulum
xla04210  Apoptosis
xla04217  Necroptosis
xla04310  Wnt signaling pathway
xla04510  Focal adhesion
xla04530  Tight junction
xla04620  Toll-like receptor signaling pathway
xla04621  NOD-like receptor signaling pathway
xla04622  RIG-I-like receptor signaling pathway
xla04625  C-type lectin receptor signaling pathway
xla04910  Insulin signaling pathway
xla04912  GnRH signaling pathway
xla04914  Progesterone-mediated oocyte maturation
xla04920  Adipocytokine signaling pathway
xla04933  AGE-RAGE signaling pathway in diabetic complications
xla05132  Salmonella infection
xla05168  Herpes simplex infection
Module
xla_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    379876 (mapk8.L)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    379876 (mapk8.L)
   04012 ErbB signaling pathway
    379876 (mapk8.L)
   04310 Wnt signaling pathway
    379876 (mapk8.L)
   04068 FoxO signaling pathway
    379876 (mapk8.L)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    379876 (mapk8.L)
   04137 Mitophagy - animal
    379876 (mapk8.L)
  Cell growth and death
   04210 Apoptosis
    379876 (mapk8.L)
   04217 Necroptosis
    379876 (mapk8.L)
  Cellular community - eukaryotes
   04510 Focal adhesion
    379876 (mapk8.L)
   04530 Tight junction
    379876 (mapk8.L)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    379876 (mapk8.L)
   04621 NOD-like receptor signaling pathway
    379876 (mapk8.L)
   04622 RIG-I-like receptor signaling pathway
    379876 (mapk8.L)
   04625 C-type lectin receptor signaling pathway
    379876 (mapk8.L)
  Endocrine system
   04910 Insulin signaling pathway
    379876 (mapk8.L)
   04920 Adipocytokine signaling pathway
    379876 (mapk8.L)
   04912 GnRH signaling pathway
    379876 (mapk8.L)
   04914 Progesterone-mediated oocyte maturation
    379876 (mapk8.L)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    379876 (mapk8.L)
  Infectious diseases
   05132 Salmonella infection
    379876 (mapk8.L)
   05168 Herpes simplex infection
    379876 (mapk8.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     379876 (mapk8.L)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   379876 (mapk8.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH RIO1 FTA2
Motif
Other DBs
NCBI-GeneID: 379876
NCBI-ProteinID: NP_001080184
Xenbase: XB-GENE-1217560
UniProt: Q8QHK8 A0A1L8FKT1
Position
7L
AA seq 426 aa AA seqDB search
MSRSKRDSNFSVFEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAFDAVLERHVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDLYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCILGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCTEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDDALQHPYINVWYDPLEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
LDWEERAKNGVIRGQPAPLGAAVTDGSQAHTSSSSGDASSMSTDPTLPSDTDSSLETSAG
TLGCCR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagccgaagcaagcgtgacagcaatttctctgtctttgagataggagattccactttc
actgttctcaagagataccaaaatctgaagcctattggatctggagcccagggaatagta
tgtgctgcctttgatgcagttctggagagacacgttgccatcaaaaaactaagccggcca
ttccagaatcaaacccatgccaagagagcttatcgggaacttgtgcttatgaaatgtgtc
aatcacaagaatataattggactcctaaatgtctttactcctcagaagtctttagaagag
tttcaggacctgtacattgttatggagcttatggatgccaacctgtgccaagtgatacag
atggaattggaccatgagcgcatgtcctacctgctgtaccagatgttatgtggcatcaaa
cacctacattctgctgggatcatccacagggatttaaagccaagtaacattgtagttaaa
tctgactgcactctcaagattcttgattttggacttgcacggacagcagggaccagtttt
atgatgacaccttacgttgttactcgttactatagagctccagaagtcatcttgggaatg
ggatataaggaaaacgttgacatttggtctgtgggttgcatcttgggagagatgatcaaa
ggtggtgtgttattccccggcacagaccatatcgaccagtggaataaagtaattgaacag
ttgggcacgccatgtacagaattcatgaaaaaattacagccaacagtgaggacatatgta
gaaaatagacccaaatacgcaggttacagctttgagaaactcttccctgatgttttattc
ccagcagactctgagcacaataagttaaaagctagccaagccagagatctgctgtcgaaa
atgctagtaatagatgcatccaagagaatctctgtagatgacgctttgcagcatccttat
atcaatgtttggtacgaccccctggaagccgaagcaccaccaccaaagattccagacaaa
caattggatgagcgagaacacactatagaagaatggaaagagctcatatacaaggaagtt
ttggactgggaagagagagctaagaatggagtaatccgtggtcagccagcccctttaggt
gcagcagtaactgatggttcccaggctcatacctcctcatcatcaggcgacgcttcctcc
atgtcaacagatccaactctgccctcagacacagacagcagccttgaaacctctgcagga
accctgggttgctgtcgatga

DBGET integrated database retrieval system