KEGG   Xenopus laevis (African clawed frog): 379876Help
Entry
379876            CDS       T01010                                 

Gene name
mapk8, jnk, jnk1, sapk1
Definition
mitogen-activated protein kinase 8 (EC:2.7.11.24)
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Adipocytokine signaling pathway
Salmonella infection
Herpes simplex infection
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:xla04141]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:xla04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:xla04012]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:xla04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:xla04068]
Cellular Processes; Cell communication; Focal adhesion [PATH:xla04510]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:xla04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:xla04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:xla04622]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:xla04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:xla04920]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:xla04912]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xla04914]
Human Diseases; Infectious diseases; Salmonella infection [PATH:xla05132]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:xla05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 426 aa AA seqDB search
MSRSKRDSNFSVFEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAFDAVLERHVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDLYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCILGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCTEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDDALQHPYINVWYDPLEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
LDWEERAKNGVIRGQPAPLGAAVTDGSQAHTSSSSGDASSMSTDPTLPSDTDSSLETSAG
TLGCCR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagccgaagcaagcgtgacagcaatttctctgtctttgagataggagattccactttc
actgttctcaagagataccaaaatctgaagcctattggatctggagcccagggaatagta
tgtgctgcctttgatgcagttctggagagacacgttgccatcaaaaaactaagccggcca
ttccagaatcaaacccatgccaagagagcttatcgggaacttgtgcttatgaaatgtgtc
aatcacaagaatataattggactcctaaatgtctttactcctcagaagtctttagaagag
tttcaggacctgtacattgttatggagcttatggatgccaacctgtgccaagtgatacag
atggaattggaccatgagcgcatgtcctacctgctgtaccagatgttatgtggcatcaaa
cacctacattctgctgggatcatccacagggatttaaagccaagtaacattgtagttaaa
tctgactgcactctcaagattcttgattttggacttgcacggacagcagggaccagtttt
atgatgacaccttacgttgttactcgttactatagagctccagaagtcatcttgggaatg
ggatataaggaaaacgttgacatttggtctgtgggttgcatcttgggagagatgatcaaa
ggtggtgtgttattccccggcacagaccatatcgaccagtggaataaagtaattgaacag
ttgggcacgccatgtacagaattcatgaaaaaattacagccaacagtgaggacatatgta
gaaaatagacccaaatacgcaggttacagctttgagaaactcttccctgatgttttattc
ccagcagactctgagcacaataagttaaaagctagccaagccagagatctgctgtcgaaa
atgctagtaatagatgcatccaagagaatctctgtagatgacgctttgcagcatccttat
atcaatgtttggtacgaccccctggaagccgaagcaccaccaccaaagattccagacaaa
caattggatgagcgagaacacactatagaagaatggaaagagctcatatacaaggaagtt
ttggactgggaagagagagctaagaatggagtaatccgtggtcagccagcccctttaggt
gcagcagtaactgatggttcccaggctcatacctcctcatcatcaggcgacgcttcctcc
atgtcaacagatccaactctgccctcagacacagacagcagccttgaaacctctgcagga
accctgggttgctgtcgatga

DBGET integrated database retrieval system