KEGG   Xenopus laevis (African clawed frog): 379954Help
Entry
379954            CDS       T01010                                 

Gene name
dyrk1a.2
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, gene 2 (EC:2.7.12.1)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     379954 (dyrk1a.2)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   379954 (dyrk1a.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 671 aa AA seqDB search
MSSQHSHAPFSSLQSMADHQQGLPDMTILQRRIPLTFRESAAAPLRKLSVDLIKTYKHIN
EVYYTKKKRRAQQVPPEDSSTKKERKVFNDGFDDDNYDYIVKNGEKWMDRYEIDSLIGKG
SFGQVVKAYDHHDQEWVAIKIIKNKKAFLNQAQIELRLLELMNKHDTEMKYYIVHLKRHF
MFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDL
KPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLG
CILVEMHTGEPLFSGSNEVDQMNKIVEVLGTPPNHMLDQAPKARKYFDKLPEGTWTVKKN
KDLKKDYKVPGTRRLHEVLGVETGGPGGRRGGEQGHSPSDYLKFKDLILRMLDYDPKTRI
TPFYALQHNFFKKTTDEGTNTSNSNSTSPAMDHSHSTSTTSSVSSSGGSSGSSNDNRNYR
YSNRYYNSAVAHTDYEMQSPQTHSQQQIRLWAGGDVPITNSDSYPQILPHKPTPSQPQHF
HGNEPHHPHPLYHHVNRPHYHRQLITSSSPQIPESMELSLGHRHPQSSSSLHPHHPSLDC
TPFGSANLHLGVSAFRTRTVSGHTDSGVPLNYPYTSNTSSMVGPPHIRNRTETEESAMLG
VCVPQSTAASS
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagccagcacagccacgctcctttttccagccttcagtcaatggctgatcatcag
cagggcctgcctgatatgaccattttacagaggcggattccattaacctttagagaatca
gcagctgcaccactaaggaagctttcggtggatttaataaagacttacaagcacataaat
gaggtgtattatactaaaaagaagcgacgagctcagcaggtgccacctgaagactccagc
acgaagaaggagagaaaagtattcaatgatggctttgatgatgacaactatgactatatt
gtaaaaaatggcgaaaagtggatggaccggtatgaaatagattccctcattggaaaagga
tcctttggacaagtggtaaaggcatatgatcatcacgatcaagaatgggtagctatcaaa
attatcaaaaataaaaaagcctttctgaaccaggctcagatcgagttgcggcttcttgag
ctaatgaacaaacatgatacggaaatgaagtattacatagtgcacttaaaacggcacttc
atgtttcgaaaccatctttgcctggtgtttgagctactgtcgtacaacttatatgatctt
ctaagaaacacaaacttccgcggcgtctccctgaacctcacccgcaagtttgcgcagcag
ctttgtactgctttgcttttcttggctactcctgaacttagtataatccattgtgacctg
aaacctgaaaatatccttctgtgtaaccctaagcgcagtgccatcaaaattgtggacttt
ggcagctcctgtcagcttggacaaaggatctaccagtatattcagagccggttttatcgt
tcacctgaagtcttgctggggatgccatacgacctggcaatagacatgtggtccttaggc
tgtattttggtggaaatgcatacaggagagcctctattcagtggatccaatgaggtggat
cagatgaacaagattgtggaggttttgggaactccccctaaccacatgttggatcaagct
ccaaaagcaaggaaatactttgacaagcttcctgaaggaacgtggactgtaaagaaaaat
aaagatctcaaaaaggactacaaggtgccagggactcgcagacttcatgaagtgttgggt
gtggaaacaggaggtcctggcggtcgcagaggaggagagcagggacactctccttcagac
tatctcaaattcaaagacttaattttaaggatgctggattatgaccccaagactagaatc
acccctttctatgccctccagcacaacttcttcaagaaaacaacagatgaagggacaaat
acaagtaatagtaactctacaagccctgcaatggaccatagtcactcaacaagtaccacc
agttctgtgtctagctcaggaggatctagtggctcttcgaatgataaccgtaattaccgg
tacagcaacagatactacaacagtgccgttgcccacacagattatgagatgcagagtcca
cagactcattcacagcagcagataagactgtgggctggtggagatgttccaatcacaaac
agcgattcctaccctcagatcttacctcacaaaccaactcccagtcagccgcagcatttt
catggaaacgaaccgcatcaccctcacccgctgtatcatcacgtaaacaggccgcactat
catcggcagctcatcacctcctcctctccgcaaatcccagagtctatggagctcagcttg
ggacacagacacccccagtcttcctcttcattgcacccacatcaccctagcttagactgc
actccttttggctccgcaaacttacacttaggagtatctgcttttcggactagaacagtc
agtgggcatacggattcgggcgtgcctctgaattacccctacactagcaacacatccagc
atggttggaccccctcacatccgaaacaggacggaaacggaagagagtgcgatgttaggc
gtttgtgttcctcagagtacggcagcaagttcttga

DBGET integrated database retrieval system