KEGG   Xenopus laevis (African clawed frog): 379981Help
Entry
379981            CDS       T01010                                 

Gene name
usp46
Definition
ubiquitin specific peptidase 46 (EC:3.1.2.15)
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     379981 (usp46)
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   379981 (usp46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 249 aa AA seqDB search
MQQDAHEFLNYLLNTIADLLLEERKQEKQNGKLQNGTLEAPEPEKSDLTWVHDIFQGTLT
NETRCLNCEAVSSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEQCRSKQE
AQKRMRVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMYD
LVAVVVHCGSGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESG
YILFYQSRD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaggatgcccatgaatttctgaactaccttctgaatactatagctgatttgctg
ctggaggagaggaagcaggaaaagcaaaatggcaagctacagaacgggaccctggaggcc
ccagagccagaaaagtctgacctcacctgggtccacgatatcttccaagggacactaacc
aatgaaacccgatgtcttaactgtgaagctgttagtagcaaagatgaagacttcctggat
ctctctgtagatgtggaacaaaacacttctattacacattgtttaaggggattcagtaat
acagaaacactatgcagtgaatataaatattattgtgagcagtgccgtagcaaacaggaa
gcacagaaaagaatgagagtaaagaagttgcctatgattctagctctgcacttaaaaagg
tttaaatacatggaccagctgcatcgatataccaaactgtcctaccgagtggtatttcca
ttggagctgcgactctttaacacctccggggatgctaccaacccagacagaatgtatgat
cttgtggcagtggtagttcactgcggaagtggaccaaatcgtggacactacattaccatt
gtaaaaagccatggattctggttgttgtttgacgacgatattgtagagaaaatcgatgca
caagccattgaggaattctatggtttgacatctgacatttccaaaaactctgagtccggt
tatatcctgttctatcaatctagagactga

DBGET integrated database retrieval system