KEGG   Xenopus laevis (African clawed frog): 379991Help
Entry
379991            CDS       T01010                                 

Gene name
map2k1, mek-2
Definition
mitogen-activated protein kinase kinase 1 (EC:2.7.12.2)
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Oocyte meiosis
Vascular smooth muscle contraction
Dorso-ventral axis formation
VEGF signaling pathway
Focal adhesion
Gap junction
Toll-like receptor signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:xla04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:xla04012]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:xla04370]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:xla04068]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:xla04810]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:xla04114]
Cellular Processes; Cell communication; Focal adhesion [PATH:xla04510]
Cellular Processes; Cell communication; Gap junction [PATH:xla04540]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:xla04620]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:xla04910]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:xla04912]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xla04914]
Organismal Systems; Endocrine system; Melanogenesis [PATH:xla04916]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:xla04270]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:xla04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 395 aa AA seqDB search
MPKKKPTPIQLNPNPEGTAVNGTPTAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKVSELGAGNGGVVFKVSHKPTSLIMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGKIPEKILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAIGRYPIPPPDAKELELIFGCSVERDPASSELAPRPRPPGRPIS
SYGPDSRPPMAIFELLDYIVNEPPPKLPSGVFGAEFQDFVNKCLVKNPAERADLKQLMVH
SFIKQSELEEVDFAGWLCSTMGLKQPSTPTHAAGV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaaagaagcctacgcccatacagctgaatcccaaccccgaagggactgctgtg
aacgggacccctacagccgagacaaaccttgaagctctgcagaaaaagttggaagagctt
gagctggatgagcagcagaggaagcgtctggaggcttttctcacccagaagcagaaagtt
ggggaactgaaggatgacgactttgaaaaagtttcagagcttggagcaggcaacggagga
gtggtgtttaaggtgtcccacaagccaaccagcttgattatggccaggaagttgattcat
ctggagattaagcctgcaatccgaaaccagattatccgagagttgcaggttctgcatgaa
tgtaactccccatacattgtggggttctatggggccttctacagtgatggagagatcagc
atttgcatggaacacatggatggaggctcccttgatcaggttctgaagaaagctggcaaa
atcccagaaaagattttgggaaaagtcagcattgcagtgataaaaggtctaacctacctg
agagaaaagcataagataatgcacagagatgtgaaaccttctaacatcctggtcaactct
agaggagagataaaactctgcgactttggggtcagcgggcaactcatagactccatggca
aattcctttgttgggacaagatcctatatgtcaccggagcgactacagggcactcattat
tctgtgcaatcagacatctggagcatggggctgtcgctggtggaaatggccattggaagg
tatcccattccaccccctgatgccaaagagctggaacttatctttgggtgttctgtagaa
agggatccagcatcttctgaactggcacctcgcccccggccacccggacgtccaataagc
tcatacggtcctgatagtcgaccacccatggctatttttgaacttctggattatatcgtg
aacgagccgcctccaaaattgcccagtggagtatttggagctgagttccaggactttgtg
aataaatgtcttgtgaagaatccggcagagagagcagaccttaaacagctaatggttcac
agcttcattaagcagtcagagttggaggaagtggattttgctggatggctctgttccact
atgggccttaagcagcccagtaccccaacccatgccgccggagtgtga

DBGET integrated database retrieval system