KEGG   Xenopus laevis (African clawed frog): 379997Help
Entry
379997            CDS       T01010                                 

Gene name
pdia6-b, erp5, pdip5, txndc7
Definition
protein disulfide isomerase family A, member 6 (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:xla04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 442 aa AA seqDB search
MARAFLGAVACTLILAASAMYSPSDDVIELTLSNFNKEVIQSDSLWLVEFYAPWCGHCQR
LTPDWKKAATALKGVVKVGAVNADQHQSLGGQYGVRGFPTIKIFGANKNKPDDYQGGRTA
DAIIDAALNSLRSFVKDRLGGRSGGSDSGRQSYSGGSGGSKKDVIDLTDDTFDKNVLNSD
DVWLVEFYAPWCGHCKTLEPEWAAAATEVKEKTNGKVKLAAVDATVSQVLASRYGIRGFP
TIKIFQKGEEPVDYDGGRTKPDIVARAVDLFSENAPPPEINEILNGDIVKKTCEEHQLCI
VAVLPHILDTGAAGRNSYLEVMLKMADKYKKKMWGWLWAEAGTQMDLETSLGIGGFGYPA
MAAINARKMKFALLKGSFSEQGINEFLRELSYGRGSTSPVGGGAIPKINTVEPWDGKDGE
LPAEDDIDLSDVELDDIGKDEL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcgagagcgtttcttggtgcagtggcctgcacattgatcttggctgcaagtgccatg
tactcacccagcgacgatgtcatcgagttgacacttagcaactttaataaagaagttatc
cagagtgacagtttatggctggtggagttttatgccccctggtgtggtcactgccagaga
ttgactccagactggaagaaagcagctacagcattaaagggagtggtgaaagtcggagct
gtcaatgctgatcagcatcagtcattgggtggtcagtatggggtgcgaggctttccaaca
atcaaaatattcggagcgaataagaacaaaccagatgattatcaaggagggaggacggcc
gatgccattatagatgctgcattaaactcacttcgttcctttgttaaggacaggcttgga
ggaaggagcggtggatctgattcaggaaggcagagctacagcggcggcagtggcgggagc
aaaaaagacgttattgacctgaccgacgacacatttgacaagaatgtactgaacagcgat
gatgtgtggcttgttgagttttatgctccctggtgtgggcattgtaaaactttagagcct
gaatgggcagctgctgccactgaggttaaggagaagaccaatggaaaagtaaaattggct
gctgtagatgccactgtcagccaggtgttggccagtcgttatgggataagaggtttcccc
acaattaagatattccagaaaggcgaagaacctgtggattatgatggcggaaggaccaag
cctgacattgtcgctcgtgcagtggatctgttctcagagaatgcaccaccccctgagatt
aatgagatcctgaatggagatatagtaaagaagacctgcgaagagcaccagttgtgtatt
gttgctgtattgccacatattcttgacacaggtgctgctggaagaaattcttacttggaa
gtaatgctgaagatggccgacaaatacaaaaagaaaatgtgggggtggttgtgggctgaa
gctggcactcagatggatctggaaacctcactgggaattggaggctttgggtaccctgcc
atggctgccatcaatgcaagaaaaatgaaatttgcacttctgaaaggttccttcagcgag
cagggcattaacgagttcttaagggagctctcttatgggcgtggttcaacatcacctgtg
ggtggaggagcaattcctaaaatcaatacagtggaaccttgggatggaaaagatggagag
ctgccagctgaggatgatatcgatctgagtgacgtggagctggacgacatcgggaaagac
gagttgtga

DBGET integrated database retrieval system