KEGG   Xenopus laevis (African clawed frog): 380007Help
Entry
380007            CDS       T01010                                 

Gene name
mylc2a
Definition
(RefSeq) myosin light chain, regulatory A
  KO
K12754  
myosin regulatory light chain 7
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Focal adhesion
Tight junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    380007 (mylc2a)
  Cellular commiunity
   04510 Focal adhesion
    380007 (mylc2a)
   04530 Tight junction
    380007 (mylc2a)
Cytoskeleton proteins [BR:xla04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     380007 (mylc2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 173 aa AA seqDB search
MASRKAAGKAAAKRAQRGSSNVFSMFEQSQIQEFKEAFSCIDQNRDGIISKPDLKETYMQ
LGKMNVNEDELDEMLIEGKGPINFTVFLSLFGEKLNGTDPEDSILSAFKILDPNATGNIN
KDELKLLLMTQADKFSAEEVDQMFAVTPIDVAGNIDYKSLCYIITHGDEKEDS
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggccagcagaaaagctgcagggaaggcggctgccaaacgtgctcagcgaggctcctct
aatgtcttctccatgtttgagcagtcacagattcaagaatttaaggaggcattcagctgt
atcgaccaaaaccgtgatgggatcataagcaaacctgacctcaaagaaacatatatgcaa
ttgggtaagatgaacgtgaatgaggatgagctggatgagatgctcatagagggcaaagga
cccattaacttcacagtcttcctgtcgttgtttggcgagaagcttaatggaacggaccca
gaagactcaatcctcagtgcattcaaaattcttgaccccaacgcaactggcaatatcaac
aaagatgaattaaagctgcttctgatgacacaagcagacaaattcagtgcagaggaggta
gaccagatgtttgccgtgaccccaattgacgtggcagggaatattgactacaagtcactg
tgttatatcatcacgcatggagatgagaaagaagactcataa

DBGET integrated database retrieval system