KEGG   Xenopus laevis (African clawed frog): 380007Help
Entry
380007            CDS       T01010                                 

Gene name
mylc2a
Definition
myosin light chain, regulatory A
Orthology
K12754  
myosin regulatory light chain 7
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Focal adhesion
Tight junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    380007 (mylc2a)
  Cellular commiunity
   04510 Focal adhesion
    380007 (mylc2a)
   04530 Tight junction
    380007 (mylc2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 173 aa AA seqDB search
MASRKAAGKAAAKRAQRGSSNVFSMFEQSQIQEFKEAFSCIDQNRDGIISKPDLKETYMQ
LGKMNVNEDELDEMLIEGKGPINFTVFLSLFGEKLNGTDPEDSILSAFKILDPNATGNIN
KDELKLLLMTQADKFSAEEVDQMFAVTPIDVAGNIDYKSLCYIITHGDEKEDS
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggccagcagaaaagctgcagggaaggcggctgccaaacgtgctcagcgaggctcctct
aatgtcttctccatgtttgagcagtcacagattcaagaatttaaggaggcattcagctgt
atcgaccaaaaccgtgatgggatcataagcaaacctgacctcaaagaaacatatatgcaa
ttgggtaagatgaacgtgaatgaggatgagctggatgagatgctcatagagggcaaagga
cccattaacttcacagtcttcctgtcgttgtttggcgagaagcttaatggaacggaccca
gaagactcaatcctcagtgcattcaaaattcttgaccccaacgcaactggcaatatcaac
aaagatgaattaaagctgcttctgatgacacaagcagacaaattcagtgcagaggaggta
gaccagatgtttgccgtgaccccaattgacgtggcagggaatattgactacaagtcactg
tgttatatcatcacgcatggagatgagaaagaagactcataa

DBGET integrated database retrieval system