KEGG   Xenopus laevis (African clawed frog): 380034Help
Entry
380034            CDS       T01010                                 

Gene name
gnai1-a, gnai1
Definition
guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1
Orthology
K04630  
guanine nucleotide-binding protein G(i) subunit alpha
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Adrenergic signaling in cardiomyocytes
Tight junction
Gap junction
Progesterone-mediated oocyte maturation
Melanogenesis
Class
Cellular Processes; Cell communication; Tight junction [PATH:xla04530]
Cellular Processes; Cell communication; Gap junction [PATH:xla04540]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xla04914]
Organismal Systems; Endocrine system; Melanogenesis [PATH:xla04916]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:xla04261]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 354 aa AA seqDB search
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDPSRADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDGGVQACFNRSREYQLNDSAAYYLNDLDRIAQNSYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYPGSNTYEEAA
AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggatgtactctgagcgccgaggacaaggcggccgtggagaggagcaaaatgatcgat
aggaacctgcgggaggatggagagaaagctgcccgggaggtgaagctgcttctgctcgga
gctggggaatctggcaaaagcacaattgttaaacaaatgaaaattatccatgaagctggt
tactcagaagaagaatgcaaacagtacaaggcagttgtttatagtaacacaattcaatcg
attattgccattattcgggcaatgggcagactgaagatagattttggtgacccttctaga
gcggatgacgcacgccagctttttgtattggctggagcagcagaagaaggttttatgaca
gcggaactggctggagttataaaaagattatggaaagatggtggtgtgcaggcttgtttc
aacaggtcaagagaatatcagctcaatgactctgcagcatattatcttaacgatttggac
aggatagcacagaacagttacataccaactcaacaggatgttctcaggactagagtgaaa
actacgggcatagtagaaactcattttactttcaaggatcttcatttcaaaatgtttgat
gtgggaggccaaagatctgaaagaaaaaaatggattcattgctttgagggtgtcacagca
ataatattctgtgtggcactgagtgattacgatttagttttagctgaagatgaggaaatg
aatcgcatgcatgaaagcatgaaactattcgacagcatctgcaataacaagtggtttaca
gacacttccattattctctttctcaataaaaaagatctgtttgaggagaaaatcaagagg
agtcctttaacaatttgttacccagaatatccaggttcaaacacctatgaagaggcggct
gcatatattcagtgtcagtttgaagatctcaataaaagaaaggatacaaaagaaatatac
acacatttcacgtgtgctacggataccaagaatgtgcagtttgtgttcgacgcagtgact
gatgtcatcataaaaaataatctcaaggactgtggccttttctaa

DBGET integrated database retrieval system