KEGG   Xenopus laevis (African clawed frog): 380061Help
Entry
380061            CDS       T01010                                 

Gene name
padi2
Definition
peptidyl arginine deiminase, type II (EC:3.5.3.15)
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     380061 (padi2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 660 aa AA seqDB search
MQKPQNRTVRLARGQRQEEVYVLGTSISIPVLGGAPAGSQWFSLHHSQNIEVSVLGSDRA
QQKVLNGEKLWPLVQESLVEIKMLAPSAETNDGKITFAYYGNGSDAPIDKAGFYFTGVEI
SLDVDADRDGVVEKNNPHKASWTWGPKGQGAVLLVNCDKDSLFARSVDGGDNIMMSKEDL
LDMSPMYLRIQGPEKLPNGYHMLLYISASDSGNLGVFHYQNTIYSHVLGKQKLFYKARYS
GTNQLQFFVEGLQFPDESFNGLVSIKVSLLESMGQGIPDTPIFTDVVTFRMAPLIITPNT
LQPIDVFVCSVKDNLFFLKAIKRLVSEANCNIKICFQDVNRGDRWMQDEIEFGYIHAPHK
SFPVVLDSPRDRGLKDFPVRNLLGPDFGYVTKLAASSEVTSLDSFGNLEVSPPVTANGKN
YPLGRILIGSSFPTSSGRRMTKAVRDFLYAQRVQSPIELYTDWLFVGHVDEFMTFVPTAD
KKGFRLLLSSPVTCFQLFRQKKDEGHGDATLFQGKESKRWTVAKVISTDSLLKENLYVQH
CIDWNRNILKQELGLTEDDIIDIPALFRLETDGQALAFFPSMVNMLVLGKELGIPKPLGP
VINESCCLEDYMVSMMKPLQLNCTFIDDFVSYHKKLGEVHCGTNTRRKPFPFPWWQMEEP
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaacctcagaaccggaccgtgcgattggcccgcgggcagagacaggaggaggtg
tatgtgctgggcacctctatatctatccctgtgctggggggggcacctgctggttcccaa
tggttctctttgcaccactctcagaatatcgaagtctcagtccttggtagtgatcgagcc
caacagaaagtgctcaatggggagaagctttggccgctggtccaggagagtttggtggaa
ataaagatgttggcaccgagcgctgagaccaatgatgggaagatcacatttgcttattac
ggcaatggctcagatgctcctatagacaaggctggattctatttcactggggttgagatc
tcattggatgttgacgcagaccgtgatggggtcgtggagaagaacaatccacacaaggcc
tcgtggacttggggccctaaggggcaaggagccgttctcctggtgaactgtgacaaggac
agtctgtttgcccgctccgttgatgggggggataatattatgatgagcaaagaagatcta
ctggacatgtcccctatgtatctccggattcaggggcccgagaagcttcccaacgggtat
cacatgctgctctacatctctgcatccgactccgggaatctgggagtctttcactaccaa
aatacgatttatagccatgttctgggcaagcagaagctgttctacaaggcccgctactca
ggaaccaatcagctgcagttctttgtggaaggtttgcagttcccagatgaatcattcaat
gggctggtgtctatcaaagtcagccttctggagtccatggggcaggggatccccgacacc
ccaatatttacagatgtggtcaccttccgcatggctcctctgatcatcaccccaaacacc
ttacagcccatagatgtttttgtatgcagtgtgaaggacaatcttttcttcctaaaggcc
atcaagaggctcgtcagtgaagccaactgcaacatcaagatctgcttccaggatgtgaac
cgtggagaccgttggatgcaggatgagattgaatttgggtacatccatgctccgcacaag
agcttccctgtggtgctggactcgccacgagaccgggggctgaaggattttcctgtccgg
aatctgctgggtccggactttggatacgtgactaaacttgcagcctcttccgaagtgacc
agcctggactcatttgggaacctggaagtcagccccccagtaacggcgaatgggaagaat
tatcccctggggcgcattttgattgggagcagcttccccacctcttctgggcggcggatg
accaaagcagtacgagactttctttatgcccaacgggtacagtcgccaattgagctctac
actgattggctgtttgtgggtcacgtggacgagtttatgacctttgtaccaacagctgat
aaaaagggattccggcttctcctctccagtccggtcacttgtttccagcttttccgacag
aagaaagacgagggacacggagacgccacattgtttcaggggaaggaaagcaagagatgg
acagttgccaaagtcatctccactgactcattactgaaggagaacctttatgtgcagcat
tgtatcgactggaataggaacatcctcaagcaggagctcggcctcaccgaagatgatatt
attgatatcccagcgctgttcaggttagagactgacggccaagcacttgctttcttccca
agcatggtgaatatgttagttctgggaaaggagctggggatccccaaacccttggggccg
gttatcaatgaaagctgctgcctggaggattatatggtgtcgatgatgaagccgctgcag
ttgaactgcacctttatagatgactttgtgtcgtaccacaagaagctgggggaggtgcac
tgcggaacaaacacgcgtcggaagccattcccgttcccctggtggcagatggaggagccg
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system