KEGG   Xenopus laevis (African clawed frog): 380068Help
Entry
380068            CDS       T01010                                 

Gene name
cdc23
Definition
CDC23 (cell division cycle 23, yeast, homolog)
Orthology
K03355  
anaphase-promoting complex subunit 8
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    380068 (cdc23)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    380068 (cdc23)
   04114 Oocyte meiosis
    380068 (cdc23)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    380068 (cdc23)
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     380068 (cdc23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 522 aa AA seqDB search
MEDAQDLDAYTLAKSYFDLKEYDRAAYFLRGCKSQKAYFLYMYSRYLSGEKKKDDETVDS
LGPLEKGQVKNEALRELRVELSKKHKARELDGFGLYLYGVVLRKLDLAKEALDVFVEATH
VLPLHWGTWLELCNLITDKEMLKFLSLPDSWIKEFFLAHIYTELQLIEEALQKYQSLIDA
GFSKSTYIISQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRGLKPELS
YLAHNLCDIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYME
MKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLV
ALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLNESEQAAQCYIKYIQDI
YSCGEIVEHQEVSTAFRYLAQYYFKCKLWDEASACAQKCFNFNDTREEGKALLRQILQCR
NQNESPSADLPATAAFFLPQSLSANNTPTRRVSPLNLSSVTP
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggaggatgcccaggacctggatgcatatacactggctaagtcttactttgacctaaaa
gaatatgatcgagctgcatattttcttcgggggtgtaaaagtcaaaaagcctatttcttg
tacatgtactccaggtatttgtctggagaaaagaagaaggacgatgaaacagttgatagc
cttggtccccttgaaaaggggcaggtaaagaatgaagcactgcgggaactacgtgtggag
ctgagtaagaagcataaagccagggaattagatggatttggactttacttgtatggagtg
gtcttgaggaagctggatctggcaaaagaagctttagatgtatttgtggaggcaacacat
gtcttgcctttgcattggggaacctggctggaattatgcaatttgattaccgacaaagag
atgctaaagttcctgtccctgccagactcatggataaaggaattcttcttggcacacata
tacacagagttacagttaatcgaggaggcattgcagaaataccaaagtcttattgatgct
ggcttctctaagagtacttacattatttctcaaattgctgttgcctatcataacatccga
gatattgacaaagctctgtctatattcaatgagctgcggaaacaggatccctacagaata
gaaaatatggacaccttttccaacctgctgtatgtcaggggtcttaaaccagaactaagc
tatctggctcacaatctctgtgacattgacaagtaccgagttgaaacgtgttgtgtaatt
ggcaattattacagccttcgctcccaacatgaaaaagcagccttgtacttccaaagggca
ttaaaactcaaccctcgatatcttggtgcgtggaccctcatgggacatgaatacatggaa
atgaagaatacctctgcagcaatacaggcttacaggcatgcaattgaagtgaacaagaga
gattatcgtgcttggtatggattaggacaaacctatgaaattttaaagatgccgttttac
tgcctttattattatagacgggcccatcagctcagacccaacgactctagaatgcttgtt
gctttgggggaatgttatgaaaagcttaatcaacttgtggaggctaaaaaatgttactgg
agagcttatgctgtgggtgatgtggagaaaatggctctggtcaagctggcaaagcttcat
gaacaactgaacgaatcggaacaggctgcccagtgttacatcaaatacatacaggacatc
tactcctgtggggaaattgtggagcaccaggaggtcagcacagcctttcgctatctggct
cagtattactttaagtgcaagctgtgggatgaggcatctgcatgtgcccagaaatgtttc
aattttaatgataccagggaagaaggcaaagctcttctacgtcagattctacagtgtagg
aaccagaatgaaagtccatcagctgatctcccagccactgctgctttcttccttccacaa
tcactttccgccaacaacacccctacaagacgagtgtctccacttaacctttcatcggtc
acaccatag

DBGET integrated database retrieval system