KEGG   Xenopus laevis (African clawed frog): 380165Help
Entry
380165            CDS       T01010                                 

Gene name
ap2b1
Definition
adaptor-related protein complex 2, beta 1 subunit
Orthology
K11825  
AP-2 complex subunit beta-1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    380165 (ap2b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 951 aa AA seqDB search
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA
VAALSEISESHPNSNLLDLNPQNISKLLTALNECTEWGQIFILDCLSNYNPKDEREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFIELLPKDSDYYTMLLKKLAPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARGAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLAFVYHKPPNAFVEGSHGVHRKHLPIQHGSI
DIGDSPVGPTPSAGLEQPQVIPSQGDLLGDLLNLDLGPPGNVPQVSTMQMGAVDLLGGGL
DSLLGSDLGGGIGGSPAVGQTFIPSSVPATFAPSPTPAVVSSGLNDLFELSSGIGMAPGG
YVAPKAVWLPAVKAKGLEISGTFSHRQSHIYMDMTFTNKALQHMTDFAIQFNKNSFGVIP
SAPLAIHTPLMPNQSIEISLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLHVLF
VEDGKMERQVFLATWKDIPNENELQFQIKDCHLNADTVSSKLQNNNVYTIAKRNVEGQDM
LYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVCNYVYQVYDSILKN
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgacagattcaaagtatttcacaactaacaaaaaaggggagatctttgagctgaaagct
gaactgaacaatgagaagaaagagaaacggaaggaagctgtaaagaaagttattgctgca
atgaccgtgggcaaagatgtcagctccctttttccagatgtggtgaactgcatgcaaaca
gacaatctggaactgaagaaacttgtttacctgtacctgatgaactatgccaaaagccag
ccagacatggcgatcatggctgtaaacagctttgtcaaggactgtgaggatccaaaccct
ctgatccgagccctggcagtgcgcaccatgggttgtatccgagttgataagatcactgag
tacctctgtgagcctttgcggaagtgcctgaaggatgaggacccatacgtgcgcaagaca
gcagcagtgtgtgtagccaaactccacgacattaatgcccagatggtggaagatcagggc
tttttggactccctgagggatctgattgctgactccaatccaatggtggtagccaatgca
gtagctgctctgtcagagatcagcgagtctcacccaaacagtaatctgttggacctgaat
ccccaaaacatcagcaaactgctaactgctcttaatgaatgcactgagtggggccagatc
ttcatcttggactgtctatcaaattataatcccaaggatgagagggaggcacagagtatc
tgtgagcgtgtcactcctcgactgtcccacgccaactctgctgtagtactgtctgctgtt
aaagtcttgatgaaattcatagagttactgcctaaagactctgactactataccatgttg
ttgaagaaactagctcctcctttggtcaccttgctgtcgggggagcctgaagtgcagtat
gtagcacttcgtaacatcaaccttattgtgcagaaaagacctgaaattctaaaacaagaa
attaaagttttctttgtaaagtacaatgatcctatttatgtcaaactggagaaactggac
ataatgattcgcctggcatcacaggctaacattgctcaggtcttggctgagctaaaggaa
tatgccactgaggtggatgttgattttgttagaaaggctgttcgtgccattggacgatgt
gccattaaagttgagcaatctgcagagcgctgcgtgagcactctcttggacctcatccag
accaaggttaactatgtggttcaagaagccattgtcgttatcagagacatcttccgcaag
tatcctaacaagtatgagagcataattgccacactgtgtgagaatctggattctttggat
gagccagatgcccgtggtgccatgatctggattgttggtgaatatgcagaacgcattgac
aatgcggatgaattactggagagcttcttggagggatttcatgatgagagtacacaggtt
caactcactctacttactgctattgtcaaactctttctgaagaagccatcagaaacccaa
gagctggttcagcaggttctcagcctggctacacaggattctgataacccagacctgcga
gacagaggctatatttactggcgattactttctactgatccagtaactgccaaagaagtg
gtgctctcagagaagccgctgatctctgaagagacagatttgattgagcccactctgctg
gatgaattaatttgccatatcggctcactggcttttgtctaccacaagccacctaatgcc
tttgtggaagggagtcacggagtacatcgcaagcaccttccaatccagcatggaagcatt
gatattggagacagccctgttggtcccactccttctgctggactcgaacagccccaggtt
attccatcacaaggtgacctccttggagatcttcttaatctcgatctgggccctccggga
aatgtgccacaagtgtccaccatgcagatgggagcagtggacctccttggtgggggtctg
gatagcttgctgggaagtgaccttggtggcggtattggtggaagtccagcggttgggcaa
accttcattccctcctcagtcccggcaacattcgctccatcccctacaccagcggtggtt
agcagtgggctaaatgacttgtttgaactctcttctggtattgggatggcacctggagga
tatgtagccccaaaagctgtctggttaccagctgtaaaagccaaaggcttggaaatctct
ggtacattctcccacagacaatcacatatctacatggatatgactttcaccaacaaagct
ctgcagcacatgactgactttgcaatacagtttaataagaacagctttggtgtcattccc
agtgcccctctggccattcatactcccctcatgcccaaccaaagtattgagatttctctt
cctcttaatacccttgggcctgttatgaaaatggagccccttaacaaccttcaggtggcc
gtgaaaaataacattgacgtgttctacttcagttgccttatccctctacatgtactgttt
gtggaagatggcaaaatggaacgtcaagtcttcctggccacatggaaggacatcccaaat
gagaatgagctacagtttcagatcaaagattgccatttgaatgcagacacagtttccagc
aaacttcagaataacaatgtgtataccattgccaagcggaatgtggaagggcaggacatg
ctgtatcaatccctcaaacttaccaatggtatttggatcctagctgagctgaggatccag
cctgggaatcctaattatacgctttctttgaagtgccgtgcaccagaggtgtgtaactac
gtttaccaagtgtatgattccatactgaagaactga

DBGET integrated database retrieval system