KEGG   Xenopus laevis (African clawed frog): 380169Help
Entry
380169            CDS       T01010                                 

Gene name
cyb5r3, dia1
Definition
cytochrome b5 reductase 3 (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:xla00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 301 aa AA seqDB search
MGAQLSTVSRILTSPFWFIFSIFQRFFGKPRPAITLESPDIKYALRLIDREEISHDTRRF
RFALPSPEHVLGLPIGQHIYLSARVDGNLVVRPYTPVSSDDNKGYVDLVVKIYFKNVHPK
FPEGGKMSQYLDSLRKDETIDFRGPSGLLVYSGKGTFQIRPDKKSPPVPKKANHLGMIAG
GTGITPMLQLIRAILKDKEDKTICYLLFANQTEKDILLRSELEEIRANHPSRFKLWYTLD
RAPEDWDYSQGFVNEDMISSFMPPPGDDVLILMCGPPPMVQYAINPSLDKLSYPQDRRFA
Y
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgggggcccagctaagcacggtgtccaggatcctcacctccccgttttggtttatcttc
agcattttccagagattcttcgggaagccgcgtcctgccatcaccttagagagccccgat
atcaaatatgcgctgaggctgatcgatagagaggagatcagccatgacaccaggaggttt
cggtttgctctcccctcccccgagcatgtcctcggcctccccattgggcagcatatttac
ctctcggcgagggtggacggcaatctggtggtcagaccctacaccccagtttccagcgat
gataataaaggttatgttgaccttgttgtgaagatctactttaaaaacgtccaccccaaa
ttcccagagggtggaaagatgtcccagtatctggactccctgaggaaagacgaaaccatt
gatttccgaggaccaagcggccttctcgtgtacagtggcaaagggaccttccagatccgc
ccagacaagaagtcccccccggtccccaaaaaagcaaatcacctgggaatgatcgctggt
gggacagggatcaccccaatgctgcagctcattcgagccatcctaaaggacaaggaggat
aaaaccatctgctacttgctctttgccaaccagacggagaaagacatcctgctccgctca
gaactggaggagatccgcgccaaccacccgtcccgcttcaaactgtggtacacgctagac
cgagcccctgaagattgggactacagccagggctttgtcaatgaagacatgatcagctcc
tttatgcctccccccggggacgacgtcctgatcctgatgtgcggcccccctcccatggtc
caatatgcaatcaaccccagcctggacaagctgtcgtacccccaggacaggagattcgcc
tactag

DBGET integrated database retrieval system