KEGG   Xenopus laevis (African clawed frog): 380177Help
Entry
380177            CDS       T01010                                 

Gene name
capn1
Definition
(RefSeq) calpain 1, (mu/I) large subunit
  KO
K01367  
calpain-1 [EC:3.4.22.52]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Necroptosis
Cellular senescence
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    380177 (capn1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    380177 (capn1)
   04217 Necroptosis
    380177 (capn1)
   04218 Cellular senescence
    380177 (capn1)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     380177 (capn1)
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C2: calpain family
   380177 (capn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
Position
4L
AA seq 713 aa AA seqDB search
MAEEVIVPVYATGISAQLQKQRDQDLGVGKHENAVKFLGQDYDRIRHECLQNGTLFKDDT
FPASAYSLGFKELGPNSSKTYGVKWVRPSQLVSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNETVLHRVVPHGQSFQENYAGVFHFQLWQFGEWVDVVIDDLLPVKDGKLVFVHS
ASGNEFWSALLEKAYAKANGCYEALSGGSTSEGFEDFTGGVTEWYEMKKAPKDLFNIILK
ALERGSLMGCSIDITSATDMEAVTFKKLVKGHAYSVTGAKEINFRGQNTKLIRMRNPWGE
VEWTGAWSDNSSEWNYVGQADSNELRIKMEDGEFWMSFEDFLREFSRLEICNLTPDALTA
RRYRKWNTTVYNGSWRKGSTAGGCRNFPATFWINPQFKIKLEEEDGDDDYGSETGCTFLL
ALMQKNKRKERRFGKDMETIGFAVYEVPREFLGQSGVHLKRDFFLQNASRARSEQFINLR
EVSTRHKLPPGEYIVVPSTFEPNVEGDFVIRVFSENKHGSVEMDDPLSADLPPEEVLSET
EIDQGFKNLFKQLAGADMEISYTELQSILNKIVSKHKDLRTTGFSLESCRSMVNLMDKDG
NGKLGLVEFNILWNKIKNYLTIFRKFDMDKSGSMSAYEMRLALESAGFKLTNSLHQLIIT
RYSEPDMAVNFDSFTCCLIRLETMFRFFQGMDTQKQGVINFDLFSWLQMTMFA
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagaagtgatcgtgccagtttatgccactgggatttcggcgcagctgcagaag
caacgtgatcaagatctgggtgtagggaaacatgagaatgcagtcaaatttctgggacag
gattatgacaggattcgccacgagtgcctgcaaaacggaaccctctttaaggacgacaca
ttcccagcctctgcttactctctgggttttaaggagctcggcccaaactcatccaaaacc
tatggtgtaaaatgggttcggccttcgcaactcgtctccaacccacagtttattgtcgat
ggtgccacaagaacagacatctgtcagggagcattgggtgactgttggctcctcgctgct
atcgcctccctcacattaaacgaaacagtcctgcaccgtgtagtacctcatggccagagc
ttccaggagaactatgctggcgtctttcattttcagctgtggcagtttggcgagtgggtc
gatgtggttatcgatgatttgctccctgttaaagatggaaaacttgtgttcgtgcactcg
gcttctgggaatgagttctggagtgctttgctggagaaggcctatgccaaggccaacggt
tgttatgaggctctttctggaggcagcacatcagaaggttttgaggattttactggaggt
gttactgagtggtatgagatgaagaaagcacccaaagatctgtttaacattattctgaag
gcactggagcgaggttccctcatgggctgttccattgatatcactagtgccactgatatg
gaagccgtaacattcaagaagcttgtaaaaggtcacgcatactctgttacaggggccaaa
gagatcaactttaggggtcagaacaccaagctgattcggatgcgaaacccatggggtgag
gtggaatggacaggcgcatggagcgataattcatctgaatggaattatgtgggtcaagca
gacagtaacgagttgagaataaagatggaagatggagaattctggatgtcttttgaggac
ttccttcgtgaattttcccgccttgagatttgtaacctcactccagatgcactcactgcc
cgcagataccgcaagtggaacacaacagtgtacaatggttcttggaggaaaggaagcaca
gctggcggatgcagaaatttccctgccacattctggattaacccacagttcaagataaaa
ctggaggaggaggatggcgatgatgactatggctctgaaaccggttgcaccttcctcctt
gcacttatgcaaaagaacaaaagaaaagagaggcgctttgggaaagatatggagaccatt
ggattcgcagtctatgaggttcccagagagtttcttggacagtctggtgtgcatctaaag
cgggacttcttcctccaaaacgcctcccgtgctcgctcagagcagttcatcaacctgcga
gaggtcagcacccgccacaaactgccccccggagaatacattgtggtgccttctaccttt
gaacctaatgtggaaggagactttgtcattagagtcttctctgaaaacaagcatggctct
gttgagatggatgatcctttatctgctgacctacctcctgaggaagttctgtcagagact
gaaatcgatcaagggttcaagaaccttttcaagcagctagctggtgctgatatggaaatc
agttatacggagttacagtccattttaaataaaattgtatcaaaacataaagatctccgc
acaacgggatttagtttggagtcgtgccgcagcatggtgaacctgatggataaagatgga
aatgggaaattaggactggtggagttcaatattctgtggaataaaattaagaattacttg
accatattccgaaagtttgacatggataaatctggaagcatgagcgcatatgagatgcgt
ctagctttggagtctgcaggtttcaagttgaccaacagtctgcaccagctcatcatcacc
agatactcggagcctgatatggccgtgaatttcgatagcttcacatgctgtctcatcagg
ctggagactatgttccgatttttccagggtatggacacacagaaacaaggagtgatcaat
tttgacctgtttagttggctccaaatgacaatgtttgcatag

DBGET integrated database retrieval system