KEGG   Xenopus laevis (African clawed frog): 380178Help
Entry
380178            CDS       T01010                                 

Gene name
hdac6, hd6, jm21
Definition
histone deacetylase 6 (EC:3.5.1.98)
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
xla  Xenopus laevis (African clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 1286 aa AA seqDB search
MASPQDPTAVPPRGLTGASRSPVTPACSMGKPRKKGASPQGPQSLQEVKKRGHRMKRSPD
QQLCDQLEGLNLLAEAAVQGTGLVYDEQMAHNYCLWDENFPECPGRIWAVRDKMAEYGLA
ERCVAVPAREASEEEILLIHSPQYVALMRSTQKMTMDELRALSDRYDSVYLHPTSFTCAS
LAVGSVLQLVDRVQHGEIRNGLAVVRPPGHHAHTDQMNGYCMFNQLAIAARYAQLTYGAK
RVLIVDWDVHHGQGTQFIFESDPSVLYFSVHRYDNGGFWPHLKESASSAVGKERGERFNV
NVAWNKTRMSDADYIHVFLNVLLPVAYEFQPHLVLVAAGFDSVVGDPKGEMSATPACFSH
LTHLLMSLAQGRLILSLEGGYNQRSLAEGACASLKALLGDPCPRLTLPSAPCQSALDSMS
DTISAHCSLWKMLQDYESEGEPIIEPQSAKDGPPEGTDEPPLEKFLEQAMIEVMRKVPEQ
RTALVYDEQMMEHRNMWDCYHPESPQRINQIFKRHKDLGLLERCSRLPSRLATQKELQMC
HSLSYIQKIEASAHMKPRDLHRLGDEYNSIYINSKSYHSARLAAGSTFNVVEAVVTGKAQ
NGIGIVRPPGHHAEPGEACGFCFFNTVALAARYAQRLQSQSEDPLRVMILDWDVHHGNGT
QHIFQEDASVLYMSLHRYDEGLFFPNSEDASHDKVGIGKGAGYNVNIPWNGGKMGDVEYL
MAFHRVVMPIAYEFNPQLVLISAGFDAARGDPLGGCQVSPEGYAHMTHLLMSLAGGRVIL
VLEGGYNLTSISESMVMCTRSLLGDPPPVLSDLRPPKSSALNSVCKVRQAHRKYWRSLRL
NVVGPPPKSTQGAKNLQHSPMRNSPRKGRFAAEAGPLTESKISSQGASSPKKIPSEVTVT
PLASPLSSVSIEETPIPLIPDSKFSPEEVANQFVSAETAVQFAAPQYKMSTEEVANKLAS
PQGLTSLESTSSQLVSNREAIAPAWEHETPKSPPTADSQKVPMGGLVAAEDIADALAERG
LTMEILGCSEQRENVCKCKASPQSLQHEDKLLDVQSPGVRIASGKESEAPVPPCSTVEER
PLEQILRDLQLSDDASSSSSIAMAHTADLDPRDRAIRKSFITTGRDTPEEEYTEGSYIQV
ANAPPNEQELLDEAAGGSEAGNSTIGFEVFLNSMEDESDVGFAVMPLSWCPHLGSVCAVP
RDGVDVSQPCAQCGSELENWLCLTCYQVLCGRYVSQHMLSHGLTSGHHLVLSFSDLSVWC
YGCESYVHNEALFPAKSAAYSSKFEE
NT seq 3861 nt NT seq  +upstreamnt  +downstreamnt
atggcctctccacaggatcctacagcagtgcccccccgggggctgaccggtgcctcccgc
tctcctgtgacccccgcatgcagcatggggaagcccaggaagaaaggtgcatccccccaa
ggcccccagtccctgcaggaagtaaagaagaggggccacaggatgaagcgcagccctgac
cagcagctgtgtgaccaactcgaggggctgaatttgttggcagaggcagccgtgcaagga
acgggactggtttatgatgagcagatggcacacaactactgtttatgggatgaaaacttt
cctgaatgcccaggccgtatctgggctgtgagagacaagatggctgaatacggcctggca
gagcgatgtgtggcggtgccggctcgtgaagcatcagaggaggaaatcttgctcattcac
agcccccagtatgtggcactgatgagatccactcagaaaatgaccatggatgagcttaga
gctctgtctgaccgctatgattcggtgtacttgcacccgacgtctttcacttgcgcctct
ttggccgtgggctcagtgctccagctggtggatagagttcagcatggggagatccgcaat
ggattggctgttgtcaggcctcctggacatcacgcacacactgaccagatgaacggttac
tgcatgtttaaccagcttgctattgctgcccgatacgcccaactgacatatggtgccaaa
cgggtcctaattgtagactgggacgtgcatcacggtcagggcacacagttcatatttgag
agtgatcccagtgtcctgtacttttctgtccatcgctatgacaacgggggtttttggccc
catctaaaagaatcggccagttcagctgtggggaaggaacgaggagagcgattcaatgtg
aatgtggcctggaacaagaccagaatgagtgatgctgattatatccacgtgttccttaat
gtcctacttcctgtcgcctacgagttccagcctcaccttgtgttggtagcagctgggttt
gactctgtggttggagaccctaagggagagatgtcggccaccccagcgtgtttctctcac
ctcactcacctgctgatgtcactggcacagggcagactcattctttcactagagggtggg
tacaatcagcgctcattggcagaaggagcctgtgcatctctgaaagccttactgggtgac
ccgtgcccaagactgaccctgccatctgcaccctgtcaaagtgccctggattcaatgtct
gacacaataagtgcccattgcagcttatggaagatgctgcaggattacgagagtgaagga
gagcccattattgaaccccagagtgctaaagatggcccccctgaggggacagatgagcct
cctctggagaaatttctagaacaggcaatgatcgaagtgatgcggaaagtgccagagcag
cgaacagcgctggtgtatgatgagcaaatgatggagcatcgcaatatgtgggactgttat
cacccagagtctccacagaggataaaccagatatttaagcggcacaaggatctggggctg
ttagaacgttgcagtcgccttccatcacgcttggccactcagaaggagctacagatgtgc
cacagtctctcctacatccagaagattgaggcatctgctcacatgaaaccacgagacctg
cacaggctgggggatgagtacaactccatttatatcaattccaaatcctaccacagtgcc
cggctggcagctggctctaccttcaatgtagtggaggccgtggttacaggaaaggcacaa
aatggaattggcattgttcgccctccgggtcatcatgcagaaccaggggaagcctgtggt
ttctgtttctttaacaccgtggcactagctgcccgctatgcacagagactgcagagccaa
tcagaggatccactcagagtaatgattttggattgggatgtacaccatggcaatggcacg
cagcacatcttccaggaggatgccagtgtgctctacatgtccctccaccgatacgatgag
ggtctcttctttccaaattcagaagatgcatcacatgacaaggttggcattgggaagggg
gcaggatacaatgtgaacatcccttggaatggcggaaagatgggggatgtggaatattta
atggcgtttcacagagtggtgatgcccattgcttatgagtttaaccctcagctagttctc
atatcggctgggtttgacgcggcccgtggggatccacttgggggctgccaggtgagccct
gaaggttatgcccatatgacacaccttctgatgagcctggcaggtggcagagtcatcctg
gtgctagagggtgggtacaatctcacatccatctccgagtccatggttatgtgcacccga
tcgctcttgggggaccccccaccagttctgtctgacctgcgacctccaaaatcatcagct
ttgaactccgtttgcaaagtccgtcaggcacatcgcaaatactggcgcagccttcggcta
aatgtggtaggacctccccccaagtctactcagggagcaaaaaatctccagcattcccca
atgaggaactctccccgtaaaggaagatttgctgcagaggctggacccttaacagagagc
aagatctcttctcaaggagcttcatctccaaaaaaaatcccctcagaagtgacagtcacc
cccctggcatcaccactgagctcagtctccatagaagagacacctatcccattgatacca
gacagcaaattctccccagaagaggtagccaaccaatttgtatctgcagagactgctgtt
cagttcgctgcaccacagtacaagatgtccacagaggaggtagccaataagctggcatca
cctcaaggactgacatcacttgaaagtacaagcagtcagctggtatccaacagggaagcg
attgcgccagcatgggaacatgaaacccccaaatctcctcccaccgcagacagccagaaa
gtacctatgggaggattagtagcagcagaagacattgcagatgccctagcagagaggggc
cttacaatggagatattggggtgctctgagcagcgagagaatgtgtgtaaatgtaaagca
tctccacaatccttgcagcatgaggacaagttattagacgttcagtctccaggggtgaga
attgcatccgggaaagagagtgaggcaccagtgcccccctgttccactgttgaggaaaga
cctttagaacaaattctcagagacttgcagttgagtgatgatgcgtccagcagttcctcc
attgccatggctcatacagctgacttggatcctagggacagagccataaggaaatccttt
atcactacaggaagagacactccggaggaagagtatacagagggcagttatatacaggtg
gctaatgcaccacccaatgagcaggagctgctggacgaggctgcggggggctcggaagct
ggaaactccaccataggctttgaggtttttctgaactctatggaggatgagtcggatgtg
ggatttgcagtcatgccgctgtcctggtgtcctcacttgggctctgtgtgtgctgtgccc
cgggatggtgtggatgtgagccagccgtgtgcccagtgtggcagtgaactggagaactgg
ctctgtctgacttgttaccaggtgctgtgtggcaggtatgtctcccaacacatgctgagc
catggactcacctctggacatcaccttgttctcagcttctctgacttgtctgtgtggtgc
tacggctgtgagtcctatgtacataacgaggccttgtttccagccaaatctgctgcctac
agctccaagtttgaggagtag

DBGET integrated database retrieval system