KEGG   Xenopus laevis (African clawed frog): 380243Help
Entry
380243            CDS       T01010                                 

Gene name
usp8
Definition
ubiquitin specific peptidase 8 (EC:3.1.2.15)
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    380243 (usp8)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     380243 (usp8)
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   380243 (usp8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 1063 aa AA seqDB search
MPTVSALPKELYLSSSLSDLKKKAEVKPDKTSTKSYVSSACKIFQKAEECRLEGDEEKAY
VLYMKYLFVFELLKKRSDFKQNQDYYKSLLGPSTILKSVEEAEKLSESLKNRYEEAEVRK
KLEERERQEDLKKKQGKLFPKDFPEDVPSQLNTNATVNGGGNEVLSKEPEPAKVPLGAIT
AEKLFEMTNDYNISIIIMDVRNTKDFEESHIRTSISVPQEAITPGFTSSKIELNLPDESI
EMWNKRGHVDYIILLDWFSSVNDLKIGTTLQSLKDALCKWETKIILRSEPLVLDGGYENW
LLCYPMFTTNGKVTVPRKRKHESVSLSLDFNYPSLEEPTAPPSVAKEELPSVPIKVSSNE
DVINAVKTQKTEEPVHVIQKDDPVPEVHTDSVNVCHPQITAKVIPQIDRTKKPSVTVTES
TTKFKPEAKEKQAMLNGKPIPDRSTKPSLDSKSVKAEIHVQFDKNIKEKSVESKGKGIVN
AEDKADNTCAHEDKENTKRNDEKEYEMRELHKKEEIEKKHPFAAGKEPSEPKRLDSDKPS
PDDRKKNVNSSVPPEGPPANREEDKSDVTVKDSCEEDRPKREPLVRARSEEMGRTVPGMP
EGWVKFLEPITGTYRYYHSPTHTVHMYPPEMASSSTHSTTPAQKAKIQAHTDTDREQTKL
KRSYSSPDLAQAIKDEDKKKPTPHINRENKPSIVNTKAEITKLPASKIRSLNPVFGGAGP
ALTGLRNLGNTCYMNSILQCLCNTPHLAEYFNKNCYQADINRSNLLGHKGEVAEEFGCIM
KALWTGQYKCISPKDFKITIGKINEQFAGYSHQDSQELLLFLMDGLHEDLNKADNRKRQK
EENNDHLSDSQAADSAWYKHKQLNESIIVSLFQGQFKSTVQCLTCQKKSRTFEAFMYLSL
PLPSTSKCSLKDCIKAFAKEEKLTDSNRFDCSNCKTQRVATKKIEIWKLPPILLVHLKRF
SFEGRWRQKLQAYVDFPLESLDLSPYVIGPKSSKKYNLFGVSNHYGGLDGGHYTAYCKNA
LKQRWFKFDDHDVSDISVSSVKTSAAYMLFYTSLDLRGLEISA
NT seq 3192 nt NT seq  +upstreamnt  +downstreamnt
atgcctacagtgtcagcacttcccaaagaactgtatctctctagctctctatcagatctt
aaaaagaaagctgaagtcaaacctgacaagactagcacaaaaagctatgtttcctctgct
tgtaaaatatttcaaaaagcagaagagtgcagactggaaggagatgaagaaaaagcctac
gtcttgtatatgaaatatttatttgtatttgaactgcttaaaaaaagatcagatttcaag
caaaaccaggactattataagtccttacttggtccttccactatcttaaagtctgttgaa
gaagctgaaaaactctcagaaagccttaaaaatagatatgaagaagctgaagtacgaaaa
aaattagaggaaagggaaaggcaagaagacctgaagaaaaagcagggaaaactatttccc
aaagactttcctgaagatgtacccagtcagcttaatacaaatgcgacggtgaatgggggg
ggaaatgaagttttgtcaaaggagccagaacctgcaaaagtgcctcttggagctattaca
gctgaaaaactttttgagatgacaaatgattataatatcagtataattataatggatgtt
cggaatacaaaggattttgaggagtctcatattcggacttccataagtgtgccacaggag
gccataaccccaggattcacctcaagcaagattgaactgaatctccctgatgaatctata
gaaatgtggaataaaagaggtcacgtcgattacattatattgcttgattggttcagctct
gtgaatgacttaaaaattggcacaacgcttcagagcttaaaagatgctctttgtaagtgg
gaaacaaaaataatcctacggagtgaacctttggttttggacggtggttatgaaaattgg
cttctttgttatcccatgttcacaacaaatgggaaagtgactgtgcctagaaaaagaaaa
catgagtctgtatctttgtcattggacttcaattatccatctctagaagaaccaacagct
ccaccatctgttgccaaagaagagctaccctctgtacccatcaaagtaagcagcaatgag
gatgttataaatgcagttaaaacacaaaaaacagaggaacctgtccatgtaatacaaaaa
gatgaccctgtacctgaagttcatacagattctgtgaacgtctgtcacccacagattact
gcaaaagttattccacaaattgatcggacaaagaaaccctcagtaacagttactgaaagc
accacaaaatttaaacctgaagccaaagaaaaacaggcaatgctaaatggaaagcctatc
ccagaccgttccacgaaaccatcactagactccaaatctgttaaagctgagatccatgtt
cagtttgataaaaacataaaggaaaagagtgtggaaagcaaagggaaaggaatagtgaat
gcagaagacaaggctgataacacctgtgcacatgaagataaagagaacacaaagaggaat
gatgagaaagaatatgaaatgagagaattacacaaaaaggaggagattgaaaagaaacat
ccatttgctgctggaaaagaaccctctgaaccaaaaaggctggatagtgataaaccatcc
cctgatgatagaaagaaaaatgtcaattcttctgttcctcctgaagggcctccggcaaac
agagaagaagataaatctgatgtgactgtgaaagacagctgtgaagaagacagaccgaaa
cgggagcctttagttcgagcaagaagtgaggagatgggtagaactgttccaggaatgcca
gaaggttgggtgaagttccttgaacccataactggaacctaccgatattatcattcacca
acacacacggttcatatgtatcctcctgaaatggcttcttcctccacccattcaaccact
ccagctcaaaaagccaagatacaggctcacacggacactgacagggagcagaccaaatta
aaacgatcttactcatcacctgatttagcgcaagccataaaggacgaagacaagaaaaaa
ccaacgcctcatattaaccgagaaaacaaaccatcgatagtcaataccaaagctgaaatc
acaaagctaccagcatctaagatccgaagtcttaatcctgtgtttggtggtgctggtcca
gctctaactggactcaggaaccttggaaatacttgttatatgaattctatcttacagtgt
ctttgcaacactccacatttagcagagtacttcaacaaaaattgttaccaagcagacatc
aacagatcaaatctgttggggcataagggtgaagtggctgaggagtttggctgcattatg
aaagctttatggaccggtcagtacaaatgtatcagtccaaaggactttaagataacaatt
ggaaaaattaatgagcagtttgctggatacagccatcaagattcccaggaattgctgctg
tttttaatggatgggttgcatgaagatctcaataaggcggacaatcggaaaaggcaaaaa
gaagagaacaatgaccatttaagtgactcccaagctgcagattctgcatggtacaaacac
aagcaactcaatgaatcaatcattgtttcacttttccaaggccagtttaaatcaactgtg
cagtgtctaacatgccagaaaaaatccagaacatttgaggcattcatgtatttatctcta
ccacttccatcaacaagcaaatgttctcttaaggattgcattaaagcatttgccaaggaa
gagaaactcacagatagtaatagatttgattgcagtaactgtaaaactcagagggttgct
acgaaaaaaatagaaatttggaagcttccgccaattcttctagtgcacttaaaacgcttt
tcatttgaaggaaggtggaggcagaaactccaagcttatgttgattttcccttggaaagc
ttagacctttcaccatacgtcattggcccaaagagttcaaaaaaatacaatttatttgga
gtatcgaatcactacggaggtttggatggtggacactatacagcttattgcaagaatgca
ctgaaacagcgatggtttaaatttgatgaccatgacgtttccgacatatctgtatcatct
gtgaagacttcagcagcttatatgctcttttacacctccttggatctccggggccttgag
atttcagcttaa

DBGET integrated database retrieval system