KEGG   Xenopus laevis (African clawed frog): 380245Help
Entry
380245            CDS       T01010                                 

Gene name
pdgfra
Definition
platelet derived growth factor receptor, alpha polypeptide (EC:2.7.10.1)
Orthology
K04363  
platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    380245 (pdgfra)
   04020 Calcium signaling pathway
    380245 (pdgfra)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    380245 (pdgfra)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    380245 (pdgfra)
  Cell motility
   04810 Regulation of actin cytoskeleton
    380245 (pdgfra)
  Cellular commiunity
   04510 Focal adhesion
    380245 (pdgfra)
   04540 Gap junction
    380245 (pdgfra)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     380245 (pdgfra)
Protein kinases [BR:xla01001]
 Tyrosine protein kinases
  PDGFR family [OT]
   380245 (pdgfra)
Enzyme-linked receptors [BR:xla01020]
 Receptor tyrosine kinases
  RTK class III (PDGF receptor family)
   380245 (pdgfra)
Cytokine receptors [BR:xla04050]
 Receptor tyrosine kinase
  RTK class III (PDGF receptor family)
   380245 (pdgfra)
Cellular antigens [BR:xla04090]
 Proteins
  380245 (pdgfra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1087 aa AA seqDB search
MMPAMRASLILGCLLIIGPWAILAENPLPTIFPDKDELVQALHSSFTLKCTGESEVSWQN
PNSNPEKQNVVIRSEENNSGLFVSILEVSDASAFDTGLYTCYHNHTQTEESEIEGTDIYI
YVPDPNVPFAPPGLFDHIIVVEEDESALVPCRTTDPSSEVMLKNIESSRTVFAFYDSKQG
FAGNFPPGSYICETTSNKMVYQTEPYILQTWKATHNISVEMEAPKTMFRAGETIAIDCIV
LDNEVVDLKWTYPGKQRGVGIRNVEESKVPYQRLVYTLTLANATTEDSGEYECAVIHATL
DNRVVKKTNITVHEKGFIDLEPMFGSEEFANLHEVKSFIVNLHAYPTPGLFWLKDNRTLS
ENLTEITTSIVTTKETRFQSKLKLIRAKEEDSGLYTLVAQNDAETKSYSFMLQIKVPALI
LELVDKHHGASGEQTVGCLAKGMPVPDVEWLVCKDIKRCNNDTLWSILATNGSEISMETH
QDDEQIESQVTFKKIEETMAIRCIAKNELGVVARELKLVAPTLRSELTVAAAVLVLLVIV
IISLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRI
LGSGAFGKVVEGAAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGAHLNIV
NLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFQSRHPEKPKKDLDIFGLNPADESTR
SYVILSFENNGDYMDMKQADTMQYVPMLEMKEPSKYSDIQRSLYDRPASYKKKPLSEVKN
ILSDDGFEGLTVLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAHGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSFGILLWEIFSLGGTPYPGMI
VDSTFYNKIKSGYRMTKPDHATHEVYDIMVKCWNSEPEKRPSFGHLSDIVESLLPTEYKR
CYETVLHDFLKSDHPAVTRMRSDSDNSYIGVTYKNEHKMKDRESGFDEQRLSADSGYIIP
LPDIDPVSDDESGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIEMMDDIGIDPSD
LVEDSFL
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctgccatgagggcatctcttattttgggatgtctcctgattataggtccgtgg
gcaattcttgctgaaaatcctttgcccaccatatttcctgacaaggatgagttggttcag
gcgttgcactcctcctttacactaaaatgcactggcgaaagtgaggtgagctggcagaac
cccaattccaatcccgagaagcaaaatgtagtcattcgaagtgaagaaaacaacagcggc
ctctttgtgtccattctggaagtgagcgatgcgtctgcctttgatacgggactttacacc
tgctaccacaatcacacccagactgaggagagtgagattgaaggcacagatatctacatc
tatgtcccagatcctaatgttccttttgctccccctgggttatttgaccatattatcgtg
gttgaggaagatgagtctgctttggtaccttgtcgcactactgacccttcaagcgaagtg
atgctgaaaaatatagaaagttctagaactgtcttcgccttttatgacagtaagcaaggg
tttgccggaaatttccccccaggatcgtacatctgtgaaacaacctccaacaaaatggtc
tatcagacagaaccttacattttacagacatggaaagcaactcacaacatttcagttgag
atggaagcgcccaagactatgttcagagctggggaaaccattgctattgactgcattgtg
ctggacaatgaggtggtagacttgaagtggacctacccaggaaaacagagaggggttggc
attagaaatgtcgaagaaagcaaggttccgtatcagcgactggtgtacactttaaccctc
gcaaatgccactacagaagactcgggagagtacgagtgcgccgttatacatgcaaccctc
gataaccgggtagtcaagaagacaaacataacagttcatgaaaagggattcattgacctg
gagcccatgtttggatcggaggaatttgccaatctccacgaagtgaagagctttatagta
aacctgcatgcgtatcccacccctgggctcttctggctgaaggacaaccggacactgagt
gaaaatctgacagagatcaccactagcattgttacaactaaagaaaccaggtttcagagt
aaacttaaactgatccgggccaaagaagaagacagtgggctatatactctggtggcacaa
aatgatgcagaaactaaaagttactcatttatgttgcagataaaagtaccagctttgata
ttggaactggttgataagcatcatggggcatctggtgaacagactgttgggtgcttagcc
aaagggatgccggtccctgatgtggaatggctggtctgcaaggacattaaaagatgcaac
aatgacaccttgtggtccattctggcaacaaatggatcagaaatcagtatggagacccat
caagatgatgagcaaattgaaagccaggtgaccttcaagaaaattgaggagacaatggca
atccgatgtatcgcaaagaatgaacttggtgttgtggccagggaactaaagttggttgca
cctaccctgcgttcggagctaactgtggctgctgctgtcttggtccttctggtgattgtc
atcatatccctcattgtacttgtcatcatatggaaacagaaaccaaggtatgaaataaga
tggcgagtaatcgagtccatcagcccagatggccatgaatatatctatgtggatccaatg
cagcttccttatgactctcggtgggagttcccaagagatggacttgttcttggtcgcatc
cttggctctggagcttttgggaaagtggttgaaggcgccgcatatggattaagtcgttct
cagccagttatgaaagttgctgttaaaatgttgaaacctactgcccggtcaagtgaaaag
caggcactgatgtccgaactgaagattatgacgcaccttggcgcacatctcaatatagta
aatttactaggagcctgtaccaagtcgggtccaatttatatcattactgaatactgcttc
tacggtgacctcgtgaattacctgcataagaaccgggataattttcagagccgacatcca
gagaaaccaaagaaggacttggatatctttgggctgaacccagctgatgaaagcacaaga
agctacgttattttatcatttgaaaacaatggcgactacatggacatgaaacaggctgac
accatgcagtatgtacctatgctggaaatgaaagaaccctccaagtattcagatatccag
agatccttgtatgaccgtcctgcatcgtacaagaagaagcctttatcagaagtgaaaaat
atcttgtctgatgatggattcgagggtctgacagtactggatttgctcagtttcacatac
caagttgcaaggggcatggagttcttagcctctaaaaattgtgtacatcgggatttggca
gctcgaaatgtcctattagcacatgggaaaattgtgaaaatctgtgactttggcctagcg
agagacatcatgcatgactccaactacgtatccaaaggcagcactttccttcctgtgaag
tggatggcacctgaaagcatcttcgataacttgtacacaactctcagtgatgtgtggtca
tttgggatcctgctatgggaaatattctctcttggtggcacaccataccctggcatgatt
gtagactcaactttctataataagataaaaagtggctacagaatgacaaaacctgaccat
gccacccatgaagtgtatgacatcatggtaaaatgctggaacagcgaaccagagaaaagg
ccatcatttggccatctgagtgacattgttgaaagtctacttcccacggaatacaaaagg
tgctacgagacagttcttcacgacttccttaaaagtgaccaccctgcagttacccgcatg
agaagtgacagtgacaattcctacattggggtgacgtataagaatgaacacaaaatgaag
gacagagaaagcggatttgatgagcagaggctgagtgctgacagcggttacattattccc
cttcccgatattgaccccgtctcagatgatgagtctggcaagaggaacaggcacagttct
cagacatcagaagaaagtgcaatcgagactggttccagcagttccacttttataaagagg
gaggatgagaccattgaagacattgagatgatggacgacattgggattgatccctcggat
ctagtggaggacagtttcctgtga

DBGET integrated database retrieval system