KEGG   Xenopus laevis (African clawed frog): 380245Help
Entry
380245            CDS       T01010                                 

Gene name
pdgfra.L, G37, pdgfr2, pdgfra, pdgfralpha
Definition
(RefSeq) platelet-derived growth factor receptor, alpha polypeptide L homeolog
  KO
K04363  
platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    380245 (pdgfra.L)
   04020 Calcium signaling pathway
    380245 (pdgfra.L)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    380245 (pdgfra.L)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    380245 (pdgfra.L)
  Cellular community - eukaryotes
   04510 Focal adhesion
    380245 (pdgfra.L)
   04540 Gap junction
    380245 (pdgfra.L)
  Cell motility
   04810 Regulation of actin cytoskeleton
    380245 (pdgfra.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     380245 (pdgfra.L)
Protein kinases [BR:xla01001]
 Tyrosine protein kinases
  PDGFR family [OT]
   380245 (pdgfra.L)
Enzyme-linked receptors [BR:xla01020]
 Receptor tyrosine kinases
  RTK class III (PDGF receptor family)
   380245 (pdgfra.L)
Cytokine receptors [BR:xla04050]
 Receptor tyrosine kinase
  RTK class III (PDGF receptor family)
   380245 (pdgfra.L)
Cellular antigens [BR:xla04090]
 Proteins
  380245 (pdgfra.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
Position
1L
AA seq 1087 aa AA seqDB search
MMPAMRASLILGCLLIIGPWAILAENPLPTIFPDKDELVQALHSSFTLKCTGESEVSWQN
PNSNPEKQNVVIRSEENNSGLFVSILEVSDASAFDTGLYTCYHNHTQTEESEIEGTDIYI
YVPDPNVPFAPPGLFDHIIVVEEDESALVPCRTTDPSSEVMLKNIESSRTVFAFYDSKQG
FAGNFPPGSYICETTSNKMVYQTEPYILQTWKATHNISVEMEAPKTMFRAGETIAIDCIV
LDNEVVDLKWTYPGKQRGVGIRNVEESKVPYQRLVYTLTLANATTEDSGEYECAVIHATL
DNRVVKKTNITVHEKGFIDLEPMFGSEEFANLHEVKSFIVNLHAYPTPGLFWLKDNRTLS
ENLTEITTSIVTTKETRFQSKLKLIRAKEEDSGLYTLVAQNDAETKSYSFMLQIKVPALI
LELVDKHHGASGEQTVGCLAKGMPVPDVEWLVCKDIKRCNNDTLWSILATNGSEISMETH
QDDEQIESQVTFKKIEETMAIRCIAKNELGVVARELKLVAPTLRSELTVAAAVLVLLVIV
IISLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRI
LGSGAFGKVVEGAAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGAHLNIV
NLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFQSRHPEKPKKDLDIFGLNPADESTR
SYVILSFENNGDYMDMKQADTMQYVPMLEMKEPSKYSDIQRSLYDRPASYKKKPLSEVKN
ILSDDGFEGLTVLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAHGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSFGILLWEIFSLGGTPYPGMI
VDSTFYNKIKSGYRMTKPDHATHEVYDIMVKCWNSEPEKRPSFGHLSDIVESLLPTEYKR
CYETVLHDFLKSDHPAVTRMRSDSDNSYIGVTYKNEHKMKDRESGFDEQRLSADSGYIIP
LPDIDPVSDDESGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIEMMDDIGIDPSD
LVEDSFL
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctgccatgagggcatctcttattttgggatgtctcctgattataggtccgtgg
gcaattcttgctgaaaatcctttgcccaccatatttcctgacaaggatgagttggttcag
gcgttgcactcctcctttacactaaaatgcactggcgaaagtgaggtgagctggcagaac
cccaattccaatcccgagaagcaaaatgtagtcattcgaagtgaagaaaacaacagcggc
ctctttgtgtccattctggaagtgagcgatgcgtctgcctttgatacgggactttacacc
tgctaccacaatcacacccagactgaggagagtgagattgaaggcacagatatctacatc
tatgtcccagatcctaatgttccttttgctccccctgggttatttgaccatattatcgtg
gttgaggaagatgagtctgctttggtaccttgtcgcactactgacccttcaagcgaagtg
atgctgaaaaatatagaaagttctagaactgtcttcgccttttatgacagtaagcaaggg
tttgccggaaatttccccccaggatcgtacatctgtgaaacaacctccaacaaaatggtc
tatcagacagaaccttacattttacagacatggaaagcaactcacaacatttcagttgag
atggaagcgcccaagactatgttcagagctggggaaaccattgctattgactgcattgtg
ctggacaatgaggtggtagacttgaagtggacctacccaggaaaacagagaggggttggc
attagaaatgtcgaagaaagcaaggttccgtatcagcgactggtgtacactttaaccctc
gcaaatgccactacagaagactcgggagagtacgagtgcgccgttatacatgcaaccctc
gataaccgggtagtcaagaagacaaacataacagttcatgaaaagggattcattgacctg
gagcccatgtttggatcggaggaatttgccaatctccacgaagtgaagagctttatagta
aacctgcatgcgtatcccacccctgggctcttctggctgaaggacaaccggacactgagt
gaaaatctgacagagatcaccactagcattgttacaactaaagaaaccaggtttcagagt
aaacttaaactgatccgggccaaagaagaagacagtgggctatatactctggtggcacaa
aatgatgcagaaactaaaagttactcatttatgttgcagataaaagtaccagctttgata
ttggaactggttgataagcatcatggggcatctggtgaacagactgttgggtgcttagcc
aaagggatgccggtccctgatgtggaatggctggtctgcaaggacattaaaagatgcaac
aatgacaccttgtggtccattctggcaacaaatggatcagaaatcagtatggagacccat
caagatgatgagcaaattgaaagccaggtgaccttcaagaaaattgaggagacaatggca
atccgatgtatcgcaaagaatgaacttggtgttgtggccagggaactaaagttggttgca
cctaccctgcgttcggagctaactgtggctgctgctgtcttggtccttctggtgattgtc
atcatatccctcattgtacttgtcatcatatggaaacagaaaccaaggtatgaaataaga
tggcgagtaatcgagtccatcagcccagatggccatgaatatatctatgtggatccaatg
cagcttccttatgactctcggtgggagttcccaagagatggacttgttcttggtcgcatc
cttggctctggagcttttgggaaagtggttgaaggcgccgcatatggattaagtcgttct
cagccagttatgaaagttgctgttaaaatgttgaaacctactgcccggtcaagtgaaaag
caggcactgatgtccgaactgaagattatgacgcaccttggcgcacatctcaatatagta
aatttactaggagcctgtaccaagtcgggtccaatttatatcattactgaatactgcttc
tacggtgacctcgtgaattacctgcataagaaccgggataattttcagagccgacatcca
gagaaaccaaagaaggacttggatatctttgggctgaacccagctgatgaaagcacaaga
agctacgttattttatcatttgaaaacaatggcgactacatggacatgaaacaggctgac
accatgcagtatgtacctatgctggaaatgaaagaaccctccaagtattcagatatccag
agatccttgtatgaccgtcctgcatcgtacaagaagaagcctttatcagaagtgaaaaat
atcttgtctgatgatggattcgagggtctgacagtactggatttgctcagtttcacatac
caagttgcaaggggcatggagttcttagcctctaaaaattgtgtacatcgggatttggca
gctcgaaatgtcctattagcacatgggaaaattgtgaaaatctgtgactttggcctagcg
agagacatcatgcatgactccaactacgtatccaaaggcagcactttccttcctgtgaag
tggatggcacctgaaagcatcttcgataacttgtacacaactctcagtgatgtgtggtca
tttgggatcctgctatgggaaatattctctcttggtggcacaccataccctggcatgatt
gtagactcaactttctataataagataaaaagtggctacagaatgacaaaacctgaccat
gccacccatgaagtgtatgacatcatggtaaaatgctggaacagcgaaccagagaaaagg
ccatcatttggccatctgagtgacattgttgaaagtctacttcccacggaatacaaaagg
tgctacgagacagttcttcacgacttccttaaaagtgaccaccctgcagttacccgcatg
agaagtgacagtgacaattcctacattggggtgacgtataagaatgaacacaaaatgaag
gacagagaaagcggatttgatgagcagaggctgagtgctgacagcggttacattattccc
cttcccgatattgaccccgtctcagatgatgagtctggcaagaggaacaggcacagttct
cagacatcagaagaaagtgcaatcgagactggttccagcagttccacttttataaagagg
gaggatgagaccattgaagacattgagatgatggacgacattgggattgatccctcggat
ctagtggaggacagtttcctgtga

DBGET integrated database retrieval system