KEGG   Xenopus laevis (African clawed frog): 380246Help
Entry
380246            CDS       T01010                                 

Gene name
cdk1-a, PSTAIR, cdc-2, cdc2, cdc2-a, cdc28a, cdc2x1.1, p34cdc2, xcdc2
Definition
cyclin-dependent kinase 1 (EC:2.7.11.23 2.7.11.22)
Orthology
K02087  
cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Oocyte meiosis
p53 signaling pathway
Gap junction
Progesterone-mediated oocyte maturation
Herpes simplex infection
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:xla04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:xla04114]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:xla04115]
Cellular Processes; Cell communication; Gap junction [PATH:xla04540]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xla04914]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:xla05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 302 aa AA seqDB search
MDEYTKIEKIGEGTYGVVYKGRHKATGQVVAMKKIRLENEEEGVPSTAIREISLLKELQH
PNIVCLLDVLMQDSRLYLIFEFLSMDLKKYLDSIPSGQYIDTMLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDSKGVIKLADFGLARAFGIPVRVYTHEVVTLWYRAPEVLLGSVR
YSTPVDVWSIGTIFAEIATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNS
FPKWKGGSLSANVKNIDKDGLDLLAKMLIYDPAKRISARKALLHPYFDDLDKSSLPDNQI
RN
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggacgagtacactaaaatagaaaagatcggagagggcacatatggggttgtgtacaaa
ggtcgtcacaaagcaactggccaggttgttgcaatgaagaaaattcgattggaaaacgaa
gaggaaggtgtcccaagtacagcaatccgagaaatatcactacttaaagagcttcagcac
cctaacatagtttgtctcctagatgtcctcatgcaagattcaaggttgtatcttatcttt
gagtttctctccatggatctaaagaagtatttggactccatacccagcggccagtatata
gatacgatgctcgttaagagttacctataccagatcctacaaggcattgtattttgccac
tccagaagagtgctacacagagacctgaaacctcagaacctgctcatcgacagcaaggga
gtgataaagttggcagattttgggcttgccagagctttcggcattccagttcgggtttac
acacatgaggtagtgacattatggtacagagccccagaagtgctgttggggtcagtccga
tattccacgccggttgatgtttggagcataggaaccatttttgctgagattgccacaaag
aaacccctcttccacggtgactctgaaattgaccagctcttcaggatattcagagctttg
ggaacacccaacaatgaggtgtggccagaagtagaatctttacaagattacaagaactca
ttccccaaatggaaaggggggagcttgtcggcgaacgtgaaaaatatcgataaggatggg
ctggacctactggctaaaatgctaatctatgatccagccaagagaatttccgcacgtaaa
gctttgctgcacccctacttcgatgatttggataagtccagccttcctgacaatcagatt
agaaactaa

DBGET integrated database retrieval system