KEGG   Xenopus laevis (African clawed frog): 380332Help
Entry
380332            CDS       T01010                                 

Gene name
gk, gk1, gk2, gkd, gyk
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    380332 (gk)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    380332 (gk)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     380332 (gk)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   380332 (gk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 563 aa AA seqDB search
MAASNRVILGPLVGAIDQGTSSTRFLVFNAKTAELLSHHQVEIKQKFPKEGWVEQDPKEI
LRSVYECVEKTCEKLTQLNIDITNIKAIGVSNQRETTVVWDKTTGEPLYNAIVWLDLRTQ
STVERLLKRIPGKNKNFFKSRTGLPLSTYFSAVKIRWLLDNVEEIRHAVSEGRAMFGTVD
SWIIWSLTGAKNGGVHCTDVTNASRTMLFNIHTLEWDTELCQFFDIPMELLPKVRSSSEI
YGLMKICPSLKSGALTGVPISGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLCNTGSKP
VLSDHGLLTTVAYKLGRDTPACYALEGSVAIAGAVVRWLRDNLGIVKTTEEVEKLAAEVG
TSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNRNHIAFAALEAVCFQTREILDAMNQ
DCGIPLNQLQVDGGMTSNKILMQLQADILCIPVVKPSMPETTALGAAMAAGAAEGVGVWS
LNPGDLTAVTCERFEPQINPEESEFRYARWKKAVLKSMDWESAEPTSNGNGDCSIFCSLP
LGLYIVSSMVLLIGAKYISGLNK
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgtccaacagagttattctgggacctctggtgggagccattgaccaaggaacg
agttcgacacgatttctggtttttaatgcaaaaacagcagaactgctaagccaccatcaa
gtagaaatcaaacaaaagtttccaaaagaaggatgggtagagcaagatccaaaggaaatt
ttacggtctgtttatgaatgtgtagagaagacgtgtgagaagctgacccaactaaacatt
gacatcacaaatatcaaagcaattggagtcagtaaccaaagggaaacaactgtggtgtgg
gacaagacaacaggagagcctctgtacaatgctattgtttggctagatttgagaacacaa
tcaactgtagaacgacttttaaaaagaattccaggcaaaaataagaattttttcaagagt
cggactggtcttccacttagcacttacttcagtgcagtgaaaattcgatggcttctagac
aatgtggaagagattagacatgctgtttcagagggaagagcaatgtttggaacagttgat
tcctggatcatttggagtcttactggtgcaaagaatggaggggtgcattgtacagatgtg
accaatgccagcagaacaatgctgtttaatattcatacattggaatgggacacagagctc
tgccagttttttgatatacctatggaattattgccaaaagtgagaagttcatcagagatc
tacggtcttatgaaaatctgtcctagcctgaagtctggagctttgactggagttccaata
tctgggtgtttaggagaccagtcagctgctttagtaggacaaatgtgtttccaagatgga
caagctaaaaatacatatggtacaggctgctttttgctgtgcaacacaggctcaaagcct
gtgctctctgaccatggccttttgacaactgttgcttacaagctaggaagggatacacct
gcatgttatgccctcgagggttcagttgccatagcaggagcagtagtacgctggttgaga
gacaatcttggaattgtgaagactactgaggaagtagaaaaactcgctgctgaagttggg
acgtcatatggctgctactttgttcctgcattttcaggtttatacgctccctattgggag
ccgagtgccagaggtatcatctgtggcctcacccagtttacaaacagaaaccatattgca
tttgctgctcttgaagctgtgtgtttccagactagagagattctggatgctatgaaccaa
gattgtggcattcctctcaatcaacttcaggttgatgggggtatgacaagcaacaaaatc
ctaatgcagttgcaggctgatatactgtgcattccagtagtgaaaccatccatgcctgaa
acaactgcactgggtgctgctatggctgcaggcgctgctgaaggtgttggcgtctggagc
ctaaatcctggagatttaactgctgtaacatgtgaacggtttgaaccacaaatcaaccca
gaagaaagtgaatttcgatatgctagatggaaaaaggcagtgttgaaatcaatggactgg
gaatcagcagagcctacctccaatggaaatggtgactgtagtatcttctgtagtcttcct
ctggggctttatatagtgagtagcatggtattattaatcggagcaaagtacatctcaggt
cttaataaataa

DBGET integrated database retrieval system