KEGG   Xenopus laevis (African clawed frog): 380335Help
Entry
380335            CDS       T01010                                 

Gene name
usp10, usp10-B
Definition
ubiquitin specific protease 10 (EC:3.4.19.12)
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     380335 (usp10)
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   380335 (usp10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 805 aa AA seqDB search
MASPSGQYIFGEFSDDEFKQFFVTARCTVELPPYNEHFFPCGPQSSVDFQDDMHLKFSEV
IHGISGEECPRIEFGIEQVVDRDTALNNNTDYSISSNLNPQAPEFILTCSSFPKTSNNVL
HENNFDAINCQFSESAIPDGSGNADSDGTSGTGQRERKKKKKRPPGYYSYLEGVGDVPSE
TLVNGHANSTGLDSISTDDPDLADDIPISTTSPRTCTSPDNFVDLINEALSDEASMHNVL
DNARTAGQPEECSVTSSEQSCIPSDNGSESPVRTAVVQPFAGTDTTENLGVTNGQTLESP
EEDTVSNGVVLHPEVSSFSEEVKTEETSTAQALIHLSGSASSNPPAKSWASLFHTSKPSS
SPQVAYVETKNAPTVVSPQVPEKQVEIKEEPVPVSDDPVAIEFAELLEEVKLVHKPVSLQ
PRGLINKGNWCYINATLQALVACPPMYHLMKSIPVYTKAQRPCTSTPMIDSFVRLMNEFT
NMPILPKAKQAPGEKVIKDIRPGAPFEPTYIYRLLTVFKSSLSEKGRQEDAEEYLGFILN
GLHEEMLALKKLLLPQNDQIHINNCPNPVSGVEEVNKEEQEGSDEEWEQVGPRNKSSVTR
QADFVQTPITDIFGGHMRSVVYQQSSKESATLQPFFTLQLDIQSEKIRTVQDALESLVAR
ESVQGYTTKTKQEVEICRRVTLEELPPVLVLHLKRFVFEKTGGCQKLIKNIEYPVDLEVS
KDLLSPGVKSKIFKGQRTYRLFAVVYHHGNSATGGHYTTDVFQIGLNGWLRIDDQSVKVI
NQYQVVKQTVERTAYLLYYRRVDLL
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atggcctccccgagcggacagtatatatttggggagtttagtgatgatgaattcaagcag
ttctttgtgacagctcgctgcacagttgagttaccaccttacaatgaacatttttttcct
tgtggtcctcagtcttcagttgattttcaggatgacatgcatttgaaattttccgaagtc
attcatggaatatctggggaagagtgtccaagaattgagtttggtattgaacaagtagtt
gaccgtgatactgcactaaacaataacacagactacagtatttcaagtaacctaaatcct
caggctcctgagttcattctcacctgttcatcttttccgaaaacttctaataatgttctc
catgaaaataattttgatgccattaattgccagttctcagaatctgccattccagatggc
agtggcaatgcagatagtgatggtacatctggcacaggacagcgagagcgtaaaaagaag
aaaaaaagacctccgggatattatagttacttagaaggtgttggagatgttccttcagaa
accctcgtaaatggacatgccaactcaacaggacttgacagtataagcacagatgaccct
gatcttgcagacgatataccaatatctacaacctctcctaggacttgtaccagtccagat
aattttgtggaccttattaatgaagctctctctgatgaagcttctatgcataatgtacta
gacaatgctaggactgctggtcagcctgaggaatgcagtgttactagttcagaacaatct
tgcatcccctcagacaatggaagtgagagcccagtaaggacagctgttgtccagcctttt
gctggtactgatactactgaaaaccttggagttaccaatggacaaacacttgaatcccca
gaggaggacactgtttctaatggagtggtattgcatcctgaggtcagttccttctcagag
gaagttaagacagaggaaacttcaactgctcaggctctaatacatctttctggttcagcc
tcttcaaatccaccagctaaatcctgggctagtctgtttcacacttccaagccctcatca
tccccacaggtggcttatgtggagactaagaatgctcccactgtcgtatctccacaagtt
ccagagaaacaagttgagattaaagaagagcctgttccagtgtcggatgatcctgtagcc
atagagtttgcagaactcttggaagaagtcaaacttgttcacaaacctgtttcgttacag
ccacgaggattaatcaacaaaggaaactggtgctatattaatgctacactgcaggctctg
gtggcttgccctcccatgtatcaccttatgaagtccattccagtatatactaaagcccag
aggccatgtacatctactccaatgattgacagttttgtacgtttaatgaatgaattcacg
aacatgccaatacttccaaaagcaaaacaagctcctggtgagaaagttataaaggatata
cgcccaggggctccatttgaaccaacatacatttaccgcttacttactgttttcaaatca
agtctttcagaaaagggtcgtcaggaagatgcagaagagtaccttggattcatattgaat
gggttacatgaagagatgctagctctcaagaagcttcttttgccccagaatgaccaaatc
cacattaacaactgccccaatcctgtgtctggagtggaagaggttaacaaagaggaacaa
gaaggcagtgatgaggaatgggaacaagtgggacctcggaacaagtcgtccgtgacacgt
caagcagactttgttcagactccaatcacagatatatttggaggacatatgagatctgtt
gtgtaccagcagagctctaaagaatctgctactcttcagccattttttactctgcaactg
gatatccaatctgaaaagatccgcaccgtccaagatgcactcgagagcctagtggctaga
gagtctgtccagggctatacaaccaaaacaaaacaagaggtggagatctgtcgaagagtc
accttagaagaactcccacctgtactagtgttgcacctcaaacggtttgtgtttgagaag
acaggaggatgtcaaaaacttatcaagaacatcgagtacccagtggatctggaagttagt
aaagatctgctttctccaggagttaagagcaagattttcaaaggccaaagaacctacagg
ctctttgcagttgtttatcaccacggaaacagtgcaactggcggccattacactacagat
gtcttccagattggtcttaatggctggttgcgtatagatgaccagagtgtcaaagtgata
aaccagtaccaggtggtgaaacagactgtggagcgtactgcctacctcctgtattaccgc
cgtgtagatctgctgtga

DBGET integrated database retrieval system