KEGG   Xenopus laevis (African clawed frog): 380339Help
Entry
380339            CDS       T01010                                 

Gene name
thbs3, tsp-3
Definition
thrombospondin 3
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    380339 (thbs3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    380339 (thbs3)
  Cellular commiunity
   04510 Focal adhesion
    380339 (thbs3)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   380339 (thbs3)
  Exosomal proteins of colorectal cancer cells
   380339 (thbs3)
  Exosomal proteins of bladder cancer cells
   380339 (thbs3)
Heparan sulfate/heparin binding proteins [BR:xla00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  380339 (thbs3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 964 aa AA seqDB search
MGRQDPTRRHFLLLLLLLLSCFFCWAQSSRQDVHVIDLLTVSESRHMSGVVEKIRSELLG
VNDLYFLSTFRLPPKAGGVLFGLYSKKDNTKWLEASIVGKINKVLVRYMREDSKLHAVSL
QNANLSDGNMHTMILRVSGFRGDTLSLELYVDCKQVDTSMGLPEMMIIPQFEVESGDIRS
GHKAYLRMQGSVESMKLILGGSLGRVGALSECPFQEDESIHNTVNGVVNSILGEHTKALI
TQMTLFNKVLAELREDIRDQVKEMSLIRNTIMECQVCGFHEHRSRCNPNPCFPGVDCMET
YEYPGYRCGPCPTGSQGNGTYCADIDECSHANPCFSGSKCINTSPGFRCEHCPRGYKGNT
VSGVGVDYAKASKQVCRDIDECNDGNNGGCDANSICTNTVGSFRCGPCKPGFVGNQTVGC
VPKKSCASPAFNPCHVNGHCVFERNGDITCACNVGWAGNGYTCGRDTDLDGYPDKPMPCI
DNNKHCRQDNCRSTPNSGQEDADNDGIGDQCDEDADGDGIKNVEDNCRLVPNKDQQNSDT
DSFGDACDNCPNVPNNDQKDTDANGEGDACDNDIDGDGIPNMLDNCPKVPNPLQTDRDLD
GVGDACDSCPEASNPTQADADSDLVGDMCDTNQDRDGDGHQDTKDNCPDIPNSSQLDSDN
DGKGDECDQDDDNDGIPDYIPPGPDNCRLIHNPNQKDSDGDGVGDVCEEDFDNDTVIDPL
DVCPESAEVTLTDFRAYQTVILDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAF
NGVDFEGTFHVNTVTDDDHAGFIFSYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGLQL
KAVKSTTGPGEQLRNALWNTGHTQDQVRLLWKDPRNVGWKDKTSYRWQLMHRPQVGYIRV
KLYEGVDLVADSGVIIDTTMRGGRLGVFCFSQENIIWSNLQYRCNDTIPEDFEPYRRLLL
DGKN
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atggggagacaggacccaacgaggcgacatttcctactgctgctactgcttcttctctcc
tgcttcttctgctgggcacagtcatccaggcaagatgtgcacgttatcgacctcctgacg
gtcagcgagtcccggcacatgtccggtgtggtggaaaagattcgctctgagctgctgggt
gtcaatgacctctactttctctccaccttccggctgccccccaaggcaggaggggtcctg
tttggtctctactctaagaaggataacaccaaatggctggaggcctccatagtgggcaag
atcaacaaagtgctagtgcgttacatgagggaagactccaagctccatgcagtcagttta
cagaatgccaacctgtcggatggaaacatgcacactatgattctgcgtgtgagcggcttc
cggggggacacactctcattggaactgtatgtagactgcaagcaggtggacaccagcatg
gggcttccagaaatgatgatcattccccagtttgaggtggagtccggggatatccgctct
ggacacaaagcctacctaaggatgcagggatctgtggagtccatgaaactgatccttggt
gggtccctgggtcgtgtgggagcactaagtgagtgccctttccaagaagatgagtccatt
cataatacagtcaacggagtggttaattctatccttggtgagcacacgaaagctttgatc
actcaaatgactctcttcaataaagtcttagcagagctgagagaggacatacgagaccag
gttaaagagatgtcactaatcaggaataccatcatggaatgccaagtgtgcgggttccat
gagcaccgctcccgctgtaaccccaatccctgcttcccaggggtagactgtatggaaaca
tatgagtacccagggtatcgctgtggcccctgcccaactggatcccagggcaatggcacc
tactgtgctgacatagatgagtgctctcatgccaacccttgtttctctggctcaaaatgc
atcaacacatcaccaggtttccgctgcgagcactgcccacgagggtacaagggcaacact
gtgtctggggtgggagtggactatgccaaagccagtaaacaggtttgcagagacattgat
gaatgtaatgatggaaacaatggaggatgtgatgccaactccatctgcaccaacactgtg
ggatcattcagatgtggcccttgcaagcctggctttgtgggtaatcagacagtaggatgc
gtccctaaaaaatcctgtgccagcccagccttcaacccgtgccatgtgaatggacattgt
gtttttgagaggaacggagacatcacatgcgcatgtaacgttggctgggcagggaatggg
tacacgtgtggccgagacacggatctggatggatacccagataagccaatgccgtgtata
gacaacaataagcactgcaggcaggacaactgccgctcgacgcccaactctgggcaagaa
gatgccgacaatgatgggattggggaccagtgtgatgaagatgcagatggggacgggatc
aagaacgttgaggataactgccgacttgtcccaaacaaggaccagcagaactcagacact
gactcttttggcgacgcttgtgataattgccccaatgtgcccaataatgaccagaaggac
acggatgctaacggggaaggagatgcgtgtgacaatgacattgatggcgatgggatcccc
aatatgctggacaactgccccaaagtgcccaatcccctgcagacagatcgagacctcgat
ggggtgggggatgcatgtgacagttgcccggaggccagtaaccccacacaggcagatgct
gacagcgatttggttggagatatgtgcgataccaatcaggacagggatggagatggccac
caggacaccaaagacaactgcccggatatccccaacagctcccagttagactcagataat
gatgggaaaggggatgagtgtgaccaagatgatgataatgatggaatccccgattacatc
cccccaggaccagacaattgccggctgatacacaaccccaaccagaaggactcagacggg
gacggcgttggggatgtgtgcgaggaagacttcgataatgataccgtcatcgaccccctg
gatgtctgtcctgaaagtgcggaagtcactctcaccgatttcagagcctatcagactgtt
atcttagaccccgagggggatgctcagatagaccctaattgggttgtgctgaatcagggg
atggagattgttcagacgatgaacagtgaccccggcttggcagttggttacacggccttc
aacggggtggactttgaggggacattccatgtaaatactgtgaccgatgatgaccatgct
ggcttcatcttcagctatcaggacagctccagcttttatgtggtaatgtggaaacagaca
gagcagacctactggcaggcaaccccattccgagctgtagcagagcctggactacaactg
aaggctgtgaaatccacaacaggcccaggcgagcagctgcgcaatgccctatggaacacc
ggccacactcaagaccaggttcgtttgctatggaaggaccctcgtaacgttggctggaag
gacaagacttcttatcgctggcagctcatgcatagaccccaagtgggctacatcagggta
aagctgtatgaaggagttgacctggtggctgattctggagttatcatagatacaactatg
agagggggaagattgggggtcttctgcttctcccaggaaaacatcatttggtccaattta
cagtaccggtgtaatgacacaattccagaagactttgaaccataccgacgacttctactg
gatgggaaaaattaa

DBGET integrated database retrieval system