KEGG   Xenopus laevis (African clawed frog): 380351Help
Entry
380351            CDS       T01010                                 

Gene name
fzr1
Definition
fizzy/cell division cycle 20 related 1
Orthology
K03364  
cell division cycle 20-like protein 1, cofactor of APC complex
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    380351 (fzr1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    380351 (fzr1)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    380351 (fzr1)
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    target recognizing subunit
     380351 (fzr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 493 aa AA seqDB search
MDQDYERRLLRQINLQNENTIPCASEMRRTLTPTNSPMSSPSKHGDRFIPSRAGANWSIN
FHRINENEKSPSQNRKAKDATADSGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPS
TPEKKSLFTYSLSSKRASPDDGNEVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLD
APELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSER
GNLVAVGTHKGFVQIWDASAGKKLSTLEGHTARVGALAWNADQLSSGSRDRMILQRDIRT
PPVQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKA
IAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGY
SQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTK
ESVSVLNLFTRIR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggaccaggattatgagagacggcttctacggcagatcaacctccagaatgagaacacc
ataccttgtgcatcagaaatgaggaggacattaacaccaacaaactctcccatgtcttca
ccaagtaaacatggagacaggtttataccatcgcgggcaggagcgaattggagcattaac
ttccacagaataaatgagaatgaaaaatcccccagtcagaacagaaaagccaaggatgcc
acggcagacagtggcaaagatggcctagcttattcagctctgcttaagaatgagctgttg
ggagctggtattgagaaagttcaagatccacagactgaagatagacgactacaaccatca
acgccagaaaaaaagagcctgtttacgtactctctaagttctaagcgtgcaagcccagat
gatggaaatgaagtgtctccttattctttgtcacctgtcagtaataaaagccagaagcta
ttgcggtctccacgaaagcctacaaggaagatttcgaagatcccctttaaagttctggat
gcacctgagttacaagatgacttttacctcaacctagtggattggtcatccctcaatgtt
ttaagtgtgggcttgggaacttgtgtgtacttatggagtgcatgtactagccaggtgact
agactatgtgacctctctgtggaaggggattctgtaacttcagttggttggtcagagcgg
ggaaacctggtagctgtggggacacacaaaggctttgttcagatttgggatgcatcagca
gggaagaaactgtccactctggagggacacacagcccgtgtgggagccttggcttggaat
gcagaccagctttcctctgggagtagggacaggatgatcttacaaagggatattcgcaca
ccacctgttcagtcagagagaaggctgcaaggccacaggcaagaagtgtgtggcctcaag
tggtccacagaccaccagctcctggcttcaggagggaatgacaacaagctcttggtttgg
aaccattctagcctgagtcctgttcaacagtatactgaacatctagctgcagtgaaggca
attgcctggtcccctcatcaacatggccttttggcttcaggcgggggcactgctgaccgc
tgcatccgcttctggaacacactgacaggccagcctttacagtgtattgatactggctct
caagtctgtaacttggcctggtctaagcatgcaaatgaactggtaagcacacatggctac
tctcaaaatcagatattagtatggaaatatccatcgcttactcaggtggccaagttgact
ggacattcctaccgtgttctctacctggctatgtcaccagatggggaggccattgttaca
ggagcaggtgatgaaacgctgagattctggaatgtttttagcaaaacacgctccacaaag
gagtctgtctcggttctaaacctgttcacgagaatacgatag

DBGET integrated database retrieval system