KEGG   Xenopus laevis (African clawed frog): 380351Help
Entry
380351            CDS       T01010                                 

Gene name
fzr1
Definition
fizzy/cell division cycle 20 related 1
Orthology
K03364  
cell division cycle 20-like protein 1, cofactor of APC complex
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:xla04120]
Cellular Processes; Cell growth and death; Cell cycle [PATH:xla04110]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xla04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 493 aa AA seqDB search
MDQDYERRLLRQINLQNENTIPCASEMRRTLTPTNSPMSSPSKHGDRFIPSRAGANWSIN
FHRINENEKSPSQNRKAKDATADSGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPS
TPEKKSLFTYSLSSKRASPDDGNEVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLD
APELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSER
GNLVAVGTHKGFVQIWDASAGKKLSTLEGHTARVGALAWNADQLSSGSRDRMILQRDIRT
PPVQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKA
IAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGY
SQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTK
ESVSVLNLFTRIR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggaccaggattatgagagacggcttctacggcagatcaacctccagaatgagaacacc
ataccttgtgcatcagaaatgaggaggacattaacaccaacaaactctcccatgtcttca
ccaagtaaacatggagacaggtttataccatcgcgggcaggagcgaattggagcattaac
ttccacagaataaatgagaatgaaaaatcccccagtcagaacagaaaagccaaggatgcc
acggcagacagtggcaaagatggcctagcttattcagctctgcttaagaatgagctgttg
ggagctggtattgagaaagttcaagatccacagactgaagatagacgactacaaccatca
acgccagaaaaaaagagcctgtttacgtactctctaagttctaagcgtgcaagcccagat
gatggaaatgaagtgtctccttattctttgtcacctgtcagtaataaaagccagaagcta
ttgcggtctccacgaaagcctacaaggaagatttcgaagatcccctttaaagttctggat
gcacctgagttacaagatgacttttacctcaacctagtggattggtcatccctcaatgtt
ttaagtgtgggcttgggaacttgtgtgtacttatggagtgcatgtactagccaggtgact
agactatgtgacctctctgtggaaggggattctgtaacttcagttggttggtcagagcgg
ggaaacctggtagctgtggggacacacaaaggctttgttcagatttgggatgcatcagca
gggaagaaactgtccactctggagggacacacagcccgtgtgggagccttggcttggaat
gcagaccagctttcctctgggagtagggacaggatgatcttacaaagggatattcgcaca
ccacctgttcagtcagagagaaggctgcaaggccacaggcaagaagtgtgtggcctcaag
tggtccacagaccaccagctcctggcttcaggagggaatgacaacaagctcttggtttgg
aaccattctagcctgagtcctgttcaacagtatactgaacatctagctgcagtgaaggca
attgcctggtcccctcatcaacatggccttttggcttcaggcgggggcactgctgaccgc
tgcatccgcttctggaacacactgacaggccagcctttacagtgtattgatactggctct
caagtctgtaacttggcctggtctaagcatgcaaatgaactggtaagcacacatggctac
tctcaaaatcagatattagtatggaaatatccatcgcttactcaggtggccaagttgact
ggacattcctaccgtgttctctacctggctatgtcaccagatggggaggccattgttaca
ggagcaggtgatgaaacgctgagattctggaatgtttttagcaaaacacgctccacaaag
gagtctgtctcggttctaaacctgttcacgagaatacgatag

DBGET integrated database retrieval system