KEGG   Xenopus laevis (African clawed frog): 380388Help
Entry
380388            CDS       T01010                                 

Gene name
prkacb, XPKAbeta, kin-1, pkacb, prkacba
Definition
protein kinase, cAMP-dependent, catalytic, beta
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Oocyte meiosis
Apoptosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Gap junction
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    380388 (prkacb)
   04310 Wnt signaling pathway
    380388 (prkacb)
   04340 Hedgehog signaling pathway
    380388 (prkacb)
   04020 Calcium signaling pathway
    380388 (prkacb)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    380388 (prkacb)
   04210 Apoptosis
    380388 (prkacb)
  Cell communication
   04540 Gap junction
    380388 (prkacb)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    380388 (prkacb)
   04912 GnRH signaling pathway
    380388 (prkacb)
   04914 Progesterone-mediated oocyte maturation
    380388 (prkacb)
   04916 Melanogenesis
    380388 (prkacb)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    380388 (prkacb)
   04270 Vascular smooth muscle contraction
    380388 (prkacb)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     380388 (prkacb)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   380388 (prkacb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 351 aa AA seqDB search
MGNAATAKKGNEIESVKEFLAKAKEDFLRKWETPPQNTASLDDFDRMKTLGTGSFGRVML
VKHKGAEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMI
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKCRGPGDTSNFDDYEEEDIRVSLTEKCAKEFADF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgctgccaccgccaagaaggggaatgaaattgagagcgtgaaagaatttcta
gccaaagccaaagaagactttttaagaaagtgggaaacgcctcctcagaatactgcaagt
ctagatgattttgatagaatgaaaacccttggaactggctcatttggaagagttatgtta
gtgaaacataaaggtgcagagcagtattatgctatgaagatactggataaacagaaggtg
gtgaagctgaaacaaatagagcatacattaaatgaaaagaggatattgcaggcagtgaac
tttcctttccttgtcaggttggaatattcctttaaggataactctaatttatatatgatt
atggaatatgtccctgggggagaaatgttttcacatttaagaaggattggcaggttcagt
gagcctcacgcaagattttacgcagctcagatagtgctgacatttgagtacctccattca
ctagaccttatctacagagatctcaaaccagaaaatcttttaattgaccagcaaggatac
attcaggtcacagattttgggtttgccaaaagagtaaagggcagaacttggacattatgt
ggaacgccagagtatctggcaccagaaattattttaagcaagggttataacaaagcagtt
gactggtgggcattaggagttttaatatatgaaatggctgctggttatccccctttcttt
gctgatcaacccattcagatctatgaaaaaattgtgtcaggaaaggtacggtttccttcc
cacttcagctcagaccttaaagacctgctaaggaacttgctccaggtagatttgaccaaa
agatatggcaacttgaagaatggcgttaatgacatcaaaaatcacaaatggtttgctaca
acagactggattgcaatttatcagagaaaggtggaagctcccttcataccaaagtgcaga
gggcctggagataccagtaactttgatgactatgaagaagaagatattcgtgtgtctctg
acagaaaaatgtgcaaaagagtttgccgacttttag

DBGET integrated database retrieval system