KEGG   Xenopus laevis (African clawed frog): 380395Help
Entry
380395            CDS       T01010                                 

Gene name
dlst
Definition
dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    380395 (dlst)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    380395 (dlst)
  Amino acid metabolism
   00310 Lysine degradation
    380395 (dlst)
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     380395 (dlst)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 452 aa AA seqDB search
MLSRCLTRSLRRPLTALRRGPGETQSRPLVEISGCCISPATDYKPRVSSFVLSQVRFYRT
SLVYRQDAVTVNTPAFAESVTEGDVRWEKAVGDTVSEDEVVCEIETDKTSVQVPSPSAGV
IEALLVPDGGKVEGGTPLFVLRKSGAAPSKAKPAETVATPPAQVPQPAPPSAPSSGPIPT
VIPPVPPVSTQPLESKPVSAVKPSSASIVADATQPTSARSEHRVKMNRMRQRIAQRLKEA
QNTCAMLTTFNEVDMSNIQQMRSIHKDAFLKKHGLKLGFMSAFVKASAFALQDQPAVNAV
IDDTTKEIVYRDYIDISVAVSTPRGLVVPVLRNVESMNFANIERTITELGEKARKNELAI
EDMDGGTFTISNGGVFGSMFGTPIINPPQSAILGMHGIFDRPVAVSGKVEIRPMMYIALT
YDHRLIDGREAVLFLRKIKSAVEDPRVLLLDL
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccgttgccttacccggtccctacgtcgccctttgactgcacttagacggggc
cctggtgagacacagagtcgccctcttgttgagatatctgggtgctgtatatcaccagca
actgactacaagcccagagtatctagctttgttttgagccaagtccgattctacagaacc
tctcttgtctaccggcaggatgcagttactgttaatactccagcatttgcagagtctgta
acggaaggagatgtcaggtgggaaaaggctgttggtgacactgtctctgaggatgaagtg
gtttgtgagattgaaactgataagacctcagttcaggtaccatccccatctgcaggggta
attgaggctcttcttgtcccagatggaggaaaagttgaaggtggaacgccactttttgtg
ctgagaaagtctggagctgctccttctaaggccaaaccagctgagactgtggcaactcca
cctgctcaagtacctcaacctgctccaccttctgctccctcatctgggcccattcctact
gtcatcccaccggtgcctcctgtatctacacagcctctggagtccaaacctgtgtctgca
gtaaagccatcttctgcttccattgtggctgatgctacccagcctacaagtgcgcgatca
gagcatagggtgaagatgaaccggatgcgtcaaagaattgcacagcgtctgaaagaagca
cagaacacatgcgccatgctgacaactttcaatgaagttgatatgagtaacattcagcag
atgagatccatacacaaagacgccttcctgaagaaacatggcttgaaattaggattcatg
tcagcctttgttaaagcttcagcctttgctctgcaggatcagccagctgtcaatgcagtg
atcgatgatacaaccaaggagattgtgtacagagactatatagatatcagtgtggcggtg
tctaccccccggggtcttgtagttcctgtgctgagaaatgtggaatctatgaactttgca
aatatagagaggacaattaccgagctaggggaaaaggctcggaagaatgaactggctata
gaagatatggatggagggaccttcacaattagtaacggtggggtgtttggctccatgttc
gggacaccgatcattaatcccccacagtctgctatcttgggaatgcacggcatatttgat
cgtcctgtggctgtgtcgggcaaggtggagatccgtcctatgatgtatatagccctgacc
tatgatcaccgtcttatcgatggcagagaagctgtcctgttcttgcgcaagatcaaatct
gcagtagaagatccccgtgttttgctgctggatttgtga

DBGET integrated database retrieval system