KEGG   Xenopus laevis (African clawed frog): 380433Help
Entry
380433            CDS       T01010                                 

Gene name
mad2l1, XMad2, mad2
Definition
MAD2 mitotic arrest deficient-like 1
Orthology
K02537  
mitotic spindle assembly checkpoint protein MAD2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:xla04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:xla04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xla04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 203 aa AA seqDB search
MAGQLTREGITLKGSAEIVSEFFFCGINSILYQRGIYPSETFTRIQKYGLTLLVSTDPAL
KEYLNKVTDQLKDWLYKCQVQKLVVVITSIDSNEILERWQFDIECDKTVKDGIVREKSQK
VIQEEIRSVIRQITATVTFLPLLETACAFDLLIYTDKDLEVPEKWEESGPQFVSNSEEVR
LRSFTTTIHKVNSMVAYKKIDTF
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcggggcagctaacacgtgaagggattaccctgaagggcagcgcggaaatcgtatca
gagtttttcttttgtggcatcaatagtattttatatcagcgtgggatttatccatcagaa
acattcacacgtatccagaagtatgggctcacactgctagtctctacagacccagcacta
aaagagtatttaaacaaagttacagatcagcttaaagattggttgtacaaatgccaagta
cagaagcttgtggttgtgattacaagtattgacagcaatgaaattcttgaacgttggcaa
tttgatatagagtgtgacaaaactgtgaaagacggcattgttcgtgaaaaatcacaaaag
gttattcaggaagaaattcgatcagttataaggcagattactgctactgtaacttttctt
cctttgctggaaaccgcatgtgcttttgacttgctgatatatacagataaagatttggaa
gtgcctgagaaatgggaggaatctggtcctcagtttgtgtccaactctgaagaggttcgt
ctgcgctcgttcacaaccaccatccacaaagtaaatagtatggtggcatacaaaaagata
gacactttctaa

DBGET integrated database retrieval system