KEGG   Xenopus laevis (African clawed frog): 380433Help
Entry
380433            CDS       T01010                                 

Gene name
mad2l1, XMad2, mad2
Definition
MAD2 mitotic arrest deficient-like 1
Orthology
K02537  
mitotic spindle assembly checkpoint protein MAD2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    380433 (mad2l1)
   04114 Oocyte meiosis
    380433 (mad2l1)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    380433 (mad2l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 203 aa AA seqDB search
MAGQLTREGITLKGSAEIVSEFFFCGINSILYQRGIYPSETFTRIQKYGLTLLVSTDPAL
KEYLNKVTDQLKDWLYKCQVQKLVVVITSIDSNEILERWQFDIECDKTVKDGIVREKSQK
VIQEEIRSVIRQITATVTFLPLLETACAFDLLIYTDKDLEVPEKWEESGPQFVSNSEEVR
LRSFTTTIHKVNSMVAYKKIDTF
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcggggcagctaacacgtgaagggattaccctgaagggcagcgcggaaatcgtatca
gagtttttcttttgtggcatcaatagtattttatatcagcgtgggatttatccatcagaa
acattcacacgtatccagaagtatgggctcacactgctagtctctacagacccagcacta
aaagagtatttaaacaaagttacagatcagcttaaagattggttgtacaaatgccaagta
cagaagcttgtggttgtgattacaagtattgacagcaatgaaattcttgaacgttggcaa
tttgatatagagtgtgacaaaactgtgaaagacggcattgttcgtgaaaaatcacaaaag
gttattcaggaagaaattcgatcagttataaggcagattactgctactgtaacttttctt
cctttgctggaaaccgcatgtgcttttgacttgctgatatatacagataaagatttggaa
gtgcctgagaaatgggaggaatctggtcctcagtttgtgtccaactctgaagaggttcgt
ctgcgctcgttcacaaccaccatccacaaagtaaatagtatggtggcatacaaaaagata
gacactttctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system