KEGG   Xenopus laevis (African clawed frog): 380475Help
Entry
380475            CDS       T01010                                 

Gene name
pfn2, Profilin2, XProfilin2
Definition
profilin 2
Orthology
K05759  
profilin
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    380475 (pfn2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    380475 (pfn2)
Exosome [BR:xla04147]
 Exosomal proteins
  Proteins found in most exosomes
   380475 (pfn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 140 aa AA seqDB search
MSGWQDYVDMLMADGSCQEAAIVGYVDAKYVWATTPGGIFQIITPAEIDVLIGKDREGFF
TGGLTVGGKKCSVIRDSLYIENDLTMDIRTKSQGGEPTYNIAVGKAVRVLVFAMGKEGVH
GGGLNKKTYAMAKYLRDMGF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgtccggctggcaggattacgtggatatgctgatggccgatggcagctgccaggaggcc
gccattgtcggttacgtggacgccaagtacgtgtgggcgacgactccggggggaatcttt
cagattataacgcctgcagaaattgatgtgctcatagggaaggacagagaaggattcttc
actggaggcctaactgtgggaggaaagaaatgctctgttataagagacagcctctatatt
gagaacgatttaacaatggacatcaggacaaagagtcaaggaggtgaaccaacatacaat
attgctgtaggaaaagctgtaagagtcttggtgtttgcaatgggcaaggaaggcgtccac
ggcggcggcctgaacaaaaagacatacgcaatggcaaaatacttgagagatatgggattc
tag

DBGET integrated database retrieval system