KEGG   Xenopus laevis (African clawed frog): 380580Help
Entry
380580            CDS       T01010                                 

Gene name
pcmt1
Definition
protein-L-isoaspartate(D-aspartate)O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     380580 (pcmt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 228 aa AA seqDB search
MAWTSTGKTHTDLINNLRKNGVIKSQNVYDILLTTDRAHYIQYFPYMDSPQSIGYKATIS
APHMHAHALELLEDKLIEGAKALDVGSGSGYLTACFARMVGLTGKVVGIEHINHLVHDAI
QNVKQDDPTLLSSGRIKFVVGDGRLGYPDEGPYDAIHVGAAAAIVPQELLKQLKPGGRLI
LPVGPEGGSQVLEQYDKDNEGKITRARLMGVMYVPLTDKEKQWPRDEH
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcatggacctccactgggaagactcacactgaccttatcaacaatctacgcaagaat
ggtgtgatcaaatcgcagaatgtatatgatatattgctgacgacagacagagctcattat
atacagtattttccatacatggactcaccccagagcataggctacaaggcaacaatcagt
gccccacacatgcatgcacatgcactggagttgctggaagacaagctgattgaaggagcc
aaagccctggatgttggctctggaagtggatatctgactgcctgttttgccagaatggtt
ggattgactggaaaggtggttggaattgagcacattaatcatcttgttcatgatgctatt
cagaatgtgaagcaggacgatccaaccttactgagcagtggacgcatcaagtttgtggtg
ggagatggaagacttggttatccggatgaaggaccttatgatgcaattcatgttggagct
gcagctgctatagtacctcaggagttactgaaacagctgaagcctggaggaagactgatc
ttgccagtggggccggaaggtggtagccaggtattagagcaatacgacaaagacaacgaa
gggaagatcaccagagctcggctcatgggtgtcatgtatgttcctctgacagacaaagaa
aagcagtggccaagggatgagcactga

DBGET integrated database retrieval system