KEGG   Xenopus laevis (African clawed frog): 394307Help
Entry
394307            CDS       T01010                                 

Gene name
mad1-A, Xmad1
Definition
spindle checkpoint protein Xmad1
Orthology
K06638  
mitotic spindle assembly checkpoint protein MAD1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    394307 (mad1-A)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    394307 (mad1-A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 718 aa AA seqDB search
MDDSEDNTTVISTLRSFNKFLSQPLEGTAPSLGTSTSTGASLQMQFQQRFLLEDQAAQIR
SKSNLIQVEREKMQMELSHKRARIELEKAASTNAKNYEREADRNQGLHTRIKALEEKENE
FQNKLQEQNEMIKSYKKTIEAQSKKLLEKEDKLSESNENISVLKGKASELQWKIMNQEMQ
IKTQETEKQELTEQLEIHRKKLQESNEKMQALHELQAQNADNEQKIKSLEQKLSAQEQDA
AIVKSMKSDLTKLPKLERELQQLRDENAYHREMKENNALLKEEVEGLRRAAERFNKMKED
LVGSEIEKEQLVKKLKLWENLEHTTGLNIRTPDDFSRQIMAVQQRELKLKEENMTIHNSA
RMLETSRQQLQEELLKVQSGFLEEKKRREHQEALVRRLQKRVLLLTKERDGMRAILDSYD
SELTPTEHSPQLSRRLKEAEDILQKVQDHNAEMETQLSEALEDAGIQKQKSELLTAELKV
LKSQMGSSDQTMSFTNEAMSALRLKIEELEAERGRLEEENKILEMRLESLNLQGCYDPSR
TKVIHLSLNPASKAKQQRTDTVRHLQEECDKLREIVRILEGGAQIPDKLEATGSPQSSQE
LAELKKQVESAELKNQRLREVFQTKIHEFRTACYMLTGYRIDITTENQYRLTSMYGEHKE
DNLLFKASGSSGGKMQLLETDFSLTLRDFIDLHLHHQNSIPAFLSAVTLDLFSRQTFA
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggatgacagtgaagacaacaccacggtcatttccacattacggtcatttaataaattt
ctttctcagccgttggaagggacggcaccttctcttggtacttcaacatctactggggct
tcccttcagatgcagtttcagcagcgcttcctgctggaagaccaagcagcgcagattcgt
tcaaagtcaaatcttattcaggttgaacgcgaaaagatgcagatggaactaagccacaaa
cgggcccgtattgagcttgagaaagcagccagcaccaatgccaagaattacgagcgagaa
gcagacaggaaccaggggctccacacccgcatcaaagctctagaggaaaaggaaaatgag
tttcagaacaaacttcaggagcagaatgaaatgattaaatcctataagaaaaccatagag
gctcaaagcaagaagctgctggagaaagaagacaaactgtctgaatctaatgagaacatc
agtgtgttaaaaggaaaagcatctgagcttcagtggaagataatgaaccaagaaatgcaa
ataaagacccaagagactgagaagcaggagttgacagagcagctggaaatccatcgcaaa
aagctgcaagaaagcaatgagaagatgcaggcactgcatgagcttcaggcacagaatgct
gataatgaacagaaaattaagagtctggagcagaaactgtcagcccaggaacaggatgct
gccattgtgaagagcatgaaatctgatttgaccaaactgccgaaactggaaagggaatta
cagcagctcagagacgagaatgcctatcatagagaaatgaaagaaaacaatgcattgctt
aaagaggaagtagagggtctgcgccgagctgcagaacgctttaataaaatgaaagaagac
ctggtgggatcggaaattgagaaagaacaactggtaaagaagctgaaactttgggagaac
cttgagcatacaactggattaaacataagaactccagatgatttttccagacaaatcatg
gcagtgcagcagagagagctgaagctgaaagaagagaacatgacaattcataacagtgca
agaatgctggaaacatcacggcagcagcttcaagaagaacttttaaaagtccaaagtggt
ttcctggaagaaaagaaacgaagggagcatcaggaggctctggtgcggcgtctgcaaaag
agggtccttctgctgactaaggaacgggacggaatgagagccattttggattcctatgat
agtgagttgaccccaacagaacattctccccaactgagccgccgcttgaaggaagcagaa
gatattctacagaaggttcaggaccacaatgctgaaatggagacacagttgtcagaggct
ctggaagatgcaggcattcaaaagcagaagtctgaacttttaacagcagagctgaaagtc
ttgaagtctcagatgggctcatcagatcaaaccatgtcttttacaaacgaggcaatgagc
gctctcagattgaaaatagaggagcttgaagctgaacgtggtagattagaggaagagaac
aaaatattagaaatgaggctggaaagcttgaaccttcagggatgctacgacccaagcaga
acaaaagtcatccacctgagtctgaaccccgcgagtaaagccaagcagcaacgcacggac
acggtgcggcacctacaggaagaatgtgataaactgagagaaattgtacgaattctagag
gggggagcccaaatcccagataaactggaggccactggaagtccgcagtcttcacaggaa
ctggcagaactgaagaagcaggtggagagcgctgaactgaaaaaccaacgtcttcgggag
gtctttcagacgaaaatccacgagttccgtaccgcgtgctacatgctgacagggtatcgc
attgatatcaccactgagaatcagtaccgccttacttccatgtatggggaacataaagaa
gataacttgctgttcaaggcgtccggctcctctggagggaagatgcagctgttggagacg
gacttttctttaaccttgcgtgactttattgatcttcacctccatcaccagaacagcatc
ccagcattcctcagtgcagtcaccctcgacctcttcagccgccagacctttgcataa

DBGET integrated database retrieval system