KEGG   Xenopus laevis (African clawed frog): 394353Help
Entry
394353            CDS       T01010                                 

Gene name
rela, Xrel1, rela-a, xrela
Definition
v-rel avian reticuloendotheliosis viral oncogene homolog A
Orthology
K04735  
transcription factor p65
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
Apoptosis
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Adipocytokine signaling pathway
Salmonella infection
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    394353 (rela)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    394353 (rela)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    394353 (rela)
   04621 NOD-like receptor signaling pathway
    394353 (rela)
   04622 RIG-I-like receptor signaling pathway
    394353 (rela)
   04623 Cytosolic DNA-sensing pathway
    394353 (rela)
  Endocrine system
   04920 Adipocytokine signaling pathway
    394353 (rela)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    394353 (rela)
   05168 Herpes simplex infection
    394353 (rela)
Transcription factors [BR:xla03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    394353 (rela)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 527 aa AA seqDB search
MDGFHWTDIVSSMPPSIPPVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTSKTHPTI
KINNYQGPARIRISLVTKDSPHKPHPHELVGKDCKDGYYEAELSPDRSIHSFQNLGIQCV
KKREVEDAVAHRIRTNNNPFNVSPEELKADYDLNTVCLCFQVFIPDQAAGRMLPLPFVVS
QPIYDNRAPNTAELKICRVNKNSGSCLGGDEIFLLCDKVQKEDIEVIFGLGNWEARGIFS
QADVHRQVAIVFRTPAFQDTKIRQSVKVQMQLRRPSDKEVSEPMEFQYLPDEGDPHHIDE
KRKRTLDNFKHYVKNNPFAGGETRPQRRIAVANRNVPTKSEPIRPSIPVPNPVVSCLPFS
MPVLKAENVTSPSTLLSTVNISDFSNLGFSSQPPSQSDHDRLESMLNYPSFPGDANLDLV
EMLPHENESRCTSLSSIDNSDFSQLLSESQSSGTLSAALQEPGTSQGTFMAYPESIARLM
TNRPNEDEGGERIDSGLINGMFDISREEIHLTSLFELDFSSLLSNMK
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggatggattccattggacagacatagtttcaagcatgcctccctccatcccacctgtg
gaaattatagagcagccaaagcagcgagggatgcgatttcgttacaagtgtgaagggcgc
tctgctggaagcattccaggtgaacgaagcacggacacatcaaaaactcaccccactatt
aagatcaacaattaccagggcccagctcgtattcggatatctctagttacaaaggattct
ccacataaacctcaccctcatgagttggttggaaaggactgcaaggatggatattatgaa
gctgaactttccccagatcggagtatccacagcttccagaacctgggcatccagtgtgtg
aaaaagagagaggtggaagatgccgtcgcccatcgcattcggacaaataataaccccttt
aatgtgtctcctgaggagctgaaggccgattacgacctcaacacggtttgcctgtgcttc
caggttttcattcctgatcaggctgctggtcgcatgcttccattaccatttgtggtatcc
cagcccatctatgacaacagagcccctaatactgccgaactgaagatatgcagagtgaac
aaaaattccgggagctgcttgggaggagatgaaattttcttactttgtgataaagtacaa
aaagaagatatcgaggtgatattcggtttgggcaactgggaagctcgtgggatattttcc
caagcagatgttcaccgccaggtggctattgtcttccgaacccctgcttttcaagacaca
aaaatacgtcagtctgtcaaagtgcaaatgcagctgaggcggccatcagacaaagaagtc
agtgagcctatggagtttcagtatcttccagatgaaggagacccccaccatattgatgaa
aaacgaaaaaggacccttgacaatttcaagcattatgtgaaaaataatccttttgcagga
ggagaaacgcgaccccaacgcagaattgctgtggcaaatcgtaatgtgccaacaaagtca
gagcctataagacccagcatacccgttccaaatccagtggtatcctgtcttccattttcc
atgcccgttttaaaggctgagaatgtgacttcaccttcgactcttctgtccaccgtcaac
atcagcgacttcagcaatttaggattttcatcacagcctccctctcagtctgatcacgac
cgcttagaatccatgttaaactacccctcattcccaggcgatgcaaatctggatttagta
gaaatgttgccacatgagaacgaaagccgatgtaccagtttgagttctattgacaatagt
gatttcagccaacttctcagcgagtcacaatcatctgggacactctctgcagctttacaa
gagcctgggactagtcaaggcacgttcatggcttatcctgaatccattgctcgacttatg
accaaccggcccaatgaggatgagggtggagagagaattgacagtggcctgattaatggg
atgtttgatatcagcagggaggagattcatttaacctccttatttgagcttgacttttct
tctttattaagtaacatgaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system