KEGG   Xenopus laevis (African clawed frog): 394353Help
Entry
394353            CDS       T01010                                 

Gene name
rela, Xrel1, rela-a, xrela
Definition
v-rel avian reticuloendotheliosis viral oncogene homolog A
Orthology
K04735  
transcription factor p65
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
Apoptosis
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Adipocytokine signaling pathway
Salmonella infection
Herpes simplex infection
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:xla04010]
Cellular Processes; Cell growth and death; Apoptosis [PATH:xla04210]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:xla04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:xla04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:xla04622]
Organismal Systems; Immune system; Cytosolic DNA-sensing pathway [PATH:xla04623]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:xla04920]
Human Diseases; Infectious diseases; Salmonella infection [PATH:xla05132]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:xla05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 527 aa AA seqDB search
MDGFHWTDIVSSMPPSIPPVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTSKTHPTI
KINNYQGPARIRISLVTKDSPHKPHPHELVGKDCKDGYYEAELSPDRSIHSFQNLGIQCV
KKREVEDAVAHRIRTNNNPFNVSPEELKADYDLNTVCLCFQVFIPDQAAGRMLPLPFVVS
QPIYDNRAPNTAELKICRVNKNSGSCLGGDEIFLLCDKVQKEDIEVIFGLGNWEARGIFS
QADVHRQVAIVFRTPAFQDTKIRQSVKVQMQLRRPSDKEVSEPMEFQYLPDEGDPHHIDE
KRKRTLDNFKHYVKNNPFAGGETRPQRRIAVANRNVPTKSEPIRPSIPVPNPVVSCLPFS
MPVLKAENVTSPSTLLSTVNISDFSNLGFSSQPPSQSDHDRLESMLNYPSFPGDANLDLV
EMLPHENESRCTSLSSIDNSDFSQLLSESQSSGTLSAALQEPGTSQGTFMAYPESIARLM
TNRPNEDEGGERIDSGLINGMFDISREEIHLTSLFELDFSSLLSNMK
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggatggattccattggacagacatagtttcaagcatgcctccctccatcccacctgtg
gaaattatagagcagccaaagcagcgagggatgcgatttcgttacaagtgtgaagggcgc
tctgctggaagcattccaggtgaacgaagcacggacacatcaaaaactcaccccactatt
aagatcaacaattaccagggcccagctcgtattcggatatctctagttacaaaggattct
ccacataaacctcaccctcatgagttggttggaaaggactgcaaggatggatattatgaa
gctgaactttccccagatcggagtatccacagcttccagaacctgggcatccagtgtgtg
aaaaagagagaggtggaagatgccgtcgcccatcgcattcggacaaataataaccccttt
aatgtgtctcctgaggagctgaaggccgattacgacctcaacacggtttgcctgtgcttc
caggttttcattcctgatcaggctgctggtcgcatgcttccattaccatttgtggtatcc
cagcccatctatgacaacagagcccctaatactgccgaactgaagatatgcagagtgaac
aaaaattccgggagctgcttgggaggagatgaaattttcttactttgtgataaagtacaa
aaagaagatatcgaggtgatattcggtttgggcaactgggaagctcgtgggatattttcc
caagcagatgttcaccgccaggtggctattgtcttccgaacccctgcttttcaagacaca
aaaatacgtcagtctgtcaaagtgcaaatgcagctgaggcggccatcagacaaagaagtc
agtgagcctatggagtttcagtatcttccagatgaaggagacccccaccatattgatgaa
aaacgaaaaaggacccttgacaatttcaagcattatgtgaaaaataatccttttgcagga
ggagaaacgcgaccccaacgcagaattgctgtggcaaatcgtaatgtgccaacaaagtca
gagcctataagacccagcatacccgttccaaatccagtggtatcctgtcttccattttcc
atgcccgttttaaaggctgagaatgtgacttcaccttcgactcttctgtccaccgtcaac
atcagcgacttcagcaatttaggattttcatcacagcctccctctcagtctgatcacgac
cgcttagaatccatgttaaactacccctcattcccaggcgatgcaaatctggatttagta
gaaatgttgccacatgagaacgaaagccgatgtaccagtttgagttctattgacaatagt
gatttcagccaacttctcagcgagtcacaatcatctgggacactctctgcagctttacaa
gagcctgggactagtcaaggcacgttcatggcttatcctgaatccattgctcgacttatg
accaaccggcccaatgaggatgagggtggagagagaattgacagtggcctgattaatggg
atgtttgatatcagcagggaggagattcatttaacctccttatttgagcttgacttttct
tctttattaagtaacatgaaataa

DBGET integrated database retrieval system