KEGG   Xenopus laevis (African clawed frog): 394356Help
Entry
394356            CDS       T01010                                 

Gene name
ccnh, ccnh-A
Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:xla03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:xla03420]
Cellular Processes; Cell growth and death; Cell cycle [PATH:xla04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 323 aa AA seqDB search
MYHNSTQKKHWTFLSEDEPLRRRIQANVRYRARIRATEKPRLSEIFSLEPHEELAICKYY
EKRLLDFCNAFKPTMPKSVLGTACMYFKRFYLNNSVMEHHPRIIMLTCVFLACKVDEFNV
SSIQFVGNLGENPLGQEKILEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDVKTRYPM
LENPEVLRKSADEFLNRVALTDACLLFAPSVIALTAILSTASRAGLNMESYLTECLSLKD
NQETMSHLLDGMRRLKILVSKYEPARPEEVAALKKRLDHCHSTEVTLSVHGRKRKGYEDD
GYISKKPKTEEDEWTDEDFGDSL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacaacagcacgcagaagaaacactggaccttcctgagtgaagacgagccgctg
cggcggagaatccaggctaatgttcgctatcgggccagaatccgggctacagagaagcct
cgactctctgaaatatttagtctggaaccgcatgaggaattggctatttgcaaatactac
gagaagagactgttggatttctgcaatgctttcaagcccacgatgccaaaatctgttctg
ggaacagcctgcatgtatttcaaacgcttctacctcaacaattcagtaatggaacatcac
ccaagaataataatgttgacctgtgtgtttttggcttgtaaagtagatgaatttaatgta
tccagtatccagtttgtcggcaacctcggagaaaacccactgggccaggagaagattctt
gaacagatcttggaatatgaactgttactgatacagcagctgaatttccaccttatagtg
cacaatccttacagaccttttgaagggtttctaattgatgtaaagactcgatatccaatg
ctggagaatccagaggtgttgagaaaatctgctgatgagtttctgaaccgtgttgcattg
actgacgcgtgtttactgtttgcaccatcagtcatagctctcaccgctatcttatcaact
gcttcacgagcaggattaaacatggaaagttatttaacggaatgcctctcgctaaaggac
aatcaagaaaccatgtcacatttacttgatggaatgagacggctcaagatactcgtgagc
aaatatgaacctgccagaccagaagaagttgcagctttaaagaagcggctggaccattgc
catagtactgaagtaacgttgagtgttcatggacggaagagaaaaggctatgaagatgat
ggctatatatcaaagaaacctaagacagaggaggatgagtggactgacgaagattttgga
gattctctatag

DBGET integrated database retrieval system