KEGG   Xenopus laevis (African clawed frog): 394356Help
Entry
394356            CDS       T01010                                 

Gene name
ccnh, ccnh-A
Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    394356 (ccnh)
  Replication and repair
   03420 Nucleotide excision repair
    394356 (ccnh)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    394356 (ccnh)
Transcription machinery [BR:xla03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     394356 (ccnh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 323 aa AA seqDB search
MYHNSTQKKHWTFLSEDEPLRRRIQANVRYRARIRATEKPRLSEIFSLEPHEELAICKYY
EKRLLDFCNAFKPTMPKSVLGTACMYFKRFYLNNSVMEHHPRIIMLTCVFLACKVDEFNV
SSIQFVGNLGENPLGQEKILEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDVKTRYPM
LENPEVLRKSADEFLNRVALTDACLLFAPSVIALTAILSTASRAGLNMESYLTECLSLKD
NQETMSHLLDGMRRLKILVSKYEPARPEEVAALKKRLDHCHSTEVTLSVHGRKRKGYEDD
GYISKKPKTEEDEWTDEDFGDSL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacaacagcacgcagaagaaacactggaccttcctgagtgaagacgagccgctg
cggcggagaatccaggctaatgttcgctatcgggccagaatccgggctacagagaagcct
cgactctctgaaatatttagtctggaaccgcatgaggaattggctatttgcaaatactac
gagaagagactgttggatttctgcaatgctttcaagcccacgatgccaaaatctgttctg
ggaacagcctgcatgtatttcaaacgcttctacctcaacaattcagtaatggaacatcac
ccaagaataataatgttgacctgtgtgtttttggcttgtaaagtagatgaatttaatgta
tccagtatccagtttgtcggcaacctcggagaaaacccactgggccaggagaagattctt
gaacagatcttggaatatgaactgttactgatacagcagctgaatttccaccttatagtg
cacaatccttacagaccttttgaagggtttctaattgatgtaaagactcgatatccaatg
ctggagaatccagaggtgttgagaaaatctgctgatgagtttctgaaccgtgttgcattg
actgacgcgtgtttactgtttgcaccatcagtcatagctctcaccgctatcttatcaact
gcttcacgagcaggattaaacatggaaagttatttaacggaatgcctctcgctaaaggac
aatcaagaaaccatgtcacatttacttgatggaatgagacggctcaagatactcgtgagc
aaatatgaacctgccagaccagaagaagttgcagctttaaagaagcggctggaccattgc
catagtactgaagtaacgttgagtgttcatggacggaagagaaaaggctatgaagatgat
ggctatatatcaaagaaacctaagacagaggaggatgagtggactgacgaagattttgga
gattctctatag

DBGET integrated database retrieval system