KEGG   Xenopus laevis (African clawed frog): 394380Help
Entry
394380            CDS       T01010                                 

Gene name
mad2l2, mad2B, mad2l2-A, xMAD2L2
Definition
MAD2 mitotic arrest deficient-like 2
Orthology
K13728  
mitotic spindle assembly checkpoint protein MAD2B
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
Module
DNA polymerase zeta  complex
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:xla04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:xla04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xla04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 211 aa AA seqDB search
MTTLTRQDLNFGQVVADILCEFLEVAVHLILYVREVYPTGIFQKRKKYNVPVQMSCHPEL
NRYIQDTLHCVKPLIEKNDVEKVVVVILDKEHHPVERFVFEIAQPPLLSISSDSLLSHVE
QLLRAFILKISVCDAVLDNNPPGCTFTLLVHTREAATRNMEKIQVIKDFPWILADEQDVH
MQEPRLIPLKTMTSDILKMQLYVEERAQKST
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccctgacccgtcaagatctgaactttggacaggttgttgcagatatattgtgt
gaatttctagaggtggctgttcatctaatcctttatgtcagagaggtttatcctactggg
atcttccaaaagagaaagaaatataatgtcccagtacagatgtcatgtcaccctgaattg
aatcgttacatccaggacactcttcactgtgtaaaacctctcattgagaagaatgatgtg
gagaaagtggtggtagttattctagataaggaacaccatcccgtcgagcgatttgtcttt
gaaattgcacaaccacccttgctttctatcagttctgattctctgttgtctcacgttgag
cagttactccgtgcctttatcctgaagatcagtgtgtgcgatgctgtcttagacaacaat
cccccaggctgtacatttacattgcttgttcacactagagaagctgctacacgaaatatg
gagaaaattcaagttataaaggatttcccatggatcttggcagatgaacaagatgtacac
atgcaggaacctcgacttataccgctgaagacaatgacctctgatatattaaagatgcag
ctttatgtagaagaaagagcacaaaaaagtacttga

DBGET integrated database retrieval system