KEGG   Xenopus laevis (African clawed frog): 394391Help
Entry
394391            CDS       T01010                                 

Gene name
map2k7, MKK7, map2k7-A
Definition
mitogen-activated protein kinase kinase 7 (EC:2.7.12.2)
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Protein processing in endoplasmic reticulum
Toll-like receptor signaling pathway
GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    394391 (map2k7)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    394391 (map2k7)
   04012 ErbB signaling pathway
    394391 (map2k7)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    394391 (map2k7)
  Endocrine system
   04912 GnRH signaling pathway
    394391 (map2k7)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     394391 (map2k7)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   394391 (map2k7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 417 aa AA seqDB search
MAASSLEQKLSRLEAKLKQENREARRRIELEISPQRPRPTLQLPLANDGHSRSDTPPHHH
PQLTVRPRTFLSLPQTNYLTQRSLESIEIDQKLQEIIKQTGYLGIDGQKYPADINDLENL
GEIGSGTCGQVWKMRFKKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCY
GTFITNTDVFIAMELMGTCAEKLKKRIQGPIPEAILGKMTVAIVNALYYLKEKHGVIHRD
VKPSNILLDASGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRA
DVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPVLPHNMGFTLLFQSFVKDCLTK
DHRKRPKYNKLMEHPFLRRYETSEVEVASWFQDIMARTESPRSSTLLSPQNLPFFGR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcctccctggagcagaaactctcccgtctggaggcgaaattgaagcaggag
aatagggaggcccggagaagaatcgagctggagatcagccctcagcggccacggcccacc
ttacagctccctcttgccaatgatggacattcacgttcagatacccctccccatcatcat
cctcaactgacagttagaccacggacctttctgagcttgccacagaccaactacctgacg
cagcgcagtctggagagcattgaaatagaccagaagcttcaagaaattatcaagcaaacg
gggtatttaggtattgatgggcagaaatacccagcagatatcaatgacctggagaacctg
ggggagattggcagcgggacttgcggtcaagtctggaaaatgcggtttaagaagacggga
cacgtcatcgcagttaagcaaatgcgtcgctctggaaacaaggaggagaacaagcgaatt
ctgatggatttggatgttgtactaaaaagtcacgactgtccgtacattgtacagtgctat
ggtaccttcatcacaaatacagatgtattcattgcaatggagttaatggggacttgtgct
gaaaaactgaagaagagaattcaagggccaatcccggaggccattttaggaaagatgact
gtggcgatagttaatgctctatattatctgaaagagaaacatggtgttatacacagagat
gttaaaccctccaatatcctacttgatgccagtgggcagatcaaactgtgtgactttgga
atcagcgggcgccttgtggactccaaggcaaagacgaggagtgcaggctgtgctgcttac
atggcgcctgagcgaattgaccctccagatccaaccaaaccggactatgacatccgtgca
gatgtctggagtttgggaatatcactggtggagttggccaccgggcagtttccctacaaa
aactgtaagactgattttgaggttctcaccaaagttctccaagaggagccgcctgtactc
ccccacaatatgggcttcaccctgttatttcaatcatttgttaaggactgtcttactaaa
gatcacagaaagaggccaaagtacaataagctgatggagcacccattcctgcgtcggtat
gagacatctgaagtagaggttgcctcatggtttcaggatatcatggctaggacagaatcc
cccaggagcagcacactcctcagcccccaaaacctgccatttttcggcaggtag

DBGET integrated database retrieval system