KEGG   Xenopus laevis (African clawed frog): 394391Help
Entry
394391            CDS       T01010                                 

Gene name
map2k7.S, MKK7, map2k7, map2k7-A, map2k7.L
Definition
(RefSeq) mitogen-activated protein kinase kinase 7 S homeolog
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04012  ErbB signaling pathway
xla04141  Protein processing in endoplasmic reticulum
xla04530  Tight junction
xla04620  Toll-like receptor signaling pathway
xla04912  GnRH signaling pathway
Module
xla_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    394391 (map2k7.S)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    394391 (map2k7.S)
   04012 ErbB signaling pathway
    394391 (map2k7.S)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    394391 (map2k7.S)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    394391 (map2k7.S)
  Endocrine system
   04912 GnRH signaling pathway
    394391 (map2k7.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     394391 (map2k7.S)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: STE group
  STE7 family
   394391 (map2k7.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 APH
Motif
Other DBs
NCBI-GeneID: 394391
NCBI-ProteinID: NP_001081117
Xenbase: XB-GENE-865671
UniProt: Q8QHK7
Position
3L
AA seq 417 aa AA seqDB search
MAASSLEQKLSRLEAKLKQENREARRRIELEISPQRPRPTLQLPLANDGHSRSDTPPHHH
PQLTVRPRTFLSLPQTNYLTQRSLESIEIDQKLQEIIKQTGYLGIDGQKYPADINDLENL
GEIGSGTCGQVWKMRFKKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCY
GTFITNTDVFIAMELMGTCAEKLKKRIQGPIPEAILGKMTVAIVNALYYLKEKHGVIHRD
VKPSNILLDASGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRA
DVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPVLPHNMGFTLLFQSFVKDCLTK
DHRKRPKYNKLMEHPFLRRYETSEVEVASWFQDIMARTESPRSSTLLSPQNLPFFGR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcctccctggagcagaaactctcccgtctggaggcgaaattgaagcaggag
aatagggaggcccggagaagaatcgagctggagatcagccctcagcggccacggcccacc
ttacagctccctcttgccaatgatggacattcacgttcagatacccctccccatcatcat
cctcaactgacagttagaccacggacctttctgagcttgccacagaccaactacctgacg
cagcgcagtctggagagcattgaaatagaccagaagcttcaagaaattatcaagcaaacg
gggtatttaggtattgatgggcagaaatacccagcagatatcaatgacctggagaacctg
ggggagattggcagcgggacttgcggtcaagtctggaaaatgcggtttaagaagacggga
cacgtcatcgcagttaagcaaatgcgtcgctctggaaacaaggaggagaacaagcgaatt
ctgatggatttggatgttgtactaaaaagtcacgactgtccgtacattgtacagtgctat
ggtaccttcatcacaaatacagatgtattcattgcaatggagttaatggggacttgtgct
gaaaaactgaagaagagaattcaagggccaatcccggaggccattttaggaaagatgact
gtggcgatagttaatgctctatattatctgaaagagaaacatggtgttatacacagagat
gttaaaccctccaatatcctacttgatgccagtgggcagatcaaactgtgtgactttgga
atcagcgggcgccttgtggactccaaggcaaagacgaggagtgcaggctgtgctgcttac
atggcgcctgagcgaattgaccctccagatccaaccaaaccggactatgacatccgtgca
gatgtctggagtttgggaatatcactggtggagttggccaccgggcagtttccctacaaa
aactgtaagactgattttgaggttctcaccaaagttctccaagaggagccgcctgtactc
ccccacaatatgggcttcaccctgttatttcaatcatttgttaaggactgtcttactaaa
gatcacagaaagaggccaaagtacaataagctgatggagcacccattcctgcgtcggtat
gagacatctgaagtagaggttgcctcatggtttcaggatatcatggctaggacagaatcc
cccaggagcagcacactcctcagcccccaaaacctgccatttttcggcaggtag

DBGET integrated database retrieval system