KEGG   Xenopus laevis (African clawed frog): 397692Help
Entry
397692            CDS       T01010                                 

Gene name
plcb3, plc1
Definition
phospholipase C, beta 3 (phosphatidylinositol-specific)
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Gap junction
GnRH signaling pathway
Melanogenesis
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    397692 (plcb3)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    397692 (plcb3)
   04020 Calcium signaling pathway
    397692 (plcb3)
   04070 Phosphatidylinositol signaling system
    397692 (plcb3)
 Cellular Processes
  Cell communication
   04540 Gap junction
    397692 (plcb3)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    397692 (plcb3)
   04916 Melanogenesis
    397692 (plcb3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    397692 (plcb3)
   04270 Vascular smooth muscle contraction
    397692 (plcb3)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     397692 (plcb3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 1210 aa AA seqDB search
MAGARPGVHSLQLEPVKVPETLIKGSKFIKWDEESSSKSLVTLRVDTMGFYLYWTCPNME
VDILDISVIRDTRTGKYAKIPKDIKMREILGFTGPEQRPEDKLVTVVYGNDIVNISFLNF
MAVQEDTAKIWTEELFKLAHNILAQNSSRNTFLQKAYTKLKLQVNQDGRIPVKNILKMFA
ADKKRVETALESCGLNFNRGDSIKPEEFTLDIFERFLNKLCLRPDIDKILLELGAKGKPY
LTLEQLMDFLNQKQRDPRLNEILFPPLKRDQVRQLIEKYEPNRQFLDRDQMSMEGFSRFL
GGHENSIVPPEILDLSDDMNQPLSSYFINSSHNTYLTAGQLTGNSSVEMYRQVLLTGCRC
IELDCWKGRPQDEEPFITHGFTMTTEIPFKEVIEAIAESAFKTSPFPVILSFENHVDSSK
QQAKMAEYCRNIFGDALLIDPLEKYPLQPGVALPSPQELMGKILVKNKKRHKVAVKGPEG
SVKRRVSEQTSNTYSDSSSVCESSATGLPPSESADVSLTLSNGDEKIEEKPPKYTKPRKS
IDHDAYSEEEEEEEPSDPKKSDEGTASSEVNATEEMSTLVNYVEPVKFKSFDAAKKRNKY
YEMSSFVETKALEQLTKSPMEFVEYNKKQLSRIYPKGTRVDSSNYMPQLFWNAGCQMVAL
NFQTLDLPMQLNVGIFEYNRRSGYLLKPEFMCRTDKHFDPFTENIVDGIVANTVKIKIIS
GQFLSEKRVGIFVEVDMFGLPVDTKRKFRTKTSQGNSFNPVWDEEPFILPKVVLPTLATL
RIAVFEEGGKFVGHRILPVSAIRPGYHYICLRNELNQPVCLPALLVYTEVNDYIPDDHQG
YANALTNPIKHISLMDQRAKQLAALMGENEQPFNKDKIDWDPISKPPIRSRDDTPEKIKI
PIIPVPSPPAQRDDHIASVLTDIQAPSMEELKSQKSFEKLICRQYRELRQLRRKHLRKVS
SLCKEQSTWVTPLQSLRRRKPFGRSHRGVSGADQDAEQKLMDMQRDQQKRLLELREIQHE
QERKLKHSHLLQAVQKLQEVAISYHSTQLKKLKEINEKEKKELQKILDRKRHNSITEAKS
RERQKKDVELTEINRRHINESVSSIRRLEEAQKRRQEKLQTAHQETLQRIKDEEPKLQAQ
LDEACQAEFCQLPQEVRRYLQEDGWVGSGSGPPSSSHSSPPSITRSWGSESGEKDSLHSP
GDSSDEATRL
NT seq 3633 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggcacggcctggggttcactctcttcaactggagcccgtgaaagtgccggag
actcttatcaaagggagcaagttcatcaagtgggatgaggagtccagcagcaaatccctg
gttactctgcgtgtggatacaatggggttttatctttactggacctgtccaaatatggag
gttgatattttggatatcagcgtaataagagacacccggacaggaaaatatgcgaaaatt
ccaaaggatataaaaatgagggagattttgggattcacaggcccagagcagcgccctgag
gataagcttgttacagtggtatatggcaatgatattgtgaatatcagcttcctcaacttt
atggctgtgcaagaagatacagcaaagatttggacagaagagctttttaaattggcacat
aatattctggcacagaactcatctcggaacaccttcctgcagaaagcatacaccaaacta
aagctgcaagtgaatcaagatggacgaattccagttaagaatatcctaaagatgtttgca
gctgataagaaaagagtggaaacagcactggaatcttgtggcttgaactttaacaggggg
gattctattaaaccagaggaatttacactagatattttcgaacgcttcctgaacaagctg
tgtctgcgtccagatattgataagatccttctagaacttggagccaaagggaagccatat
ctgactctggagcaactaatggacttcctaaatcagaaacaaagggacccccggctcaat
gagattcttttccctccactaaaaagagaccaagtgcggcagctcattgagaagtatgag
cccaacaggcagttcctggacagagaccagatgtcgatggaaggtttcagccgcttttta
ggtgggcatgagaacagcattgttcccccggagatccttgatctaagtgatgatatgaac
cagccgctcagcagctactttattaactcctcccataacacctacctcacagctggccag
ctaactggaaattcatcagtggagatgtacaggcaagtgctgttgactggctgccgctgt
attgagctagattgctggaagggtcgtccgcaggatgaagaaccattcataacccatgga
ttcactatgaccaccgaaattccttttaaggaagtaattgaagcaatagcagaaagtgcc
tttaaaacatcgccgttcccagtcattttgtcatttgaaaatcatgttgactcttcaaag
cagcaagcaaagatggccgagtactgcaggaacatcttcggagatgcgttgttaatagac
ccgctggagaagtatcctctccagcctggagttgcacttcctagtccccaggaacttatg
ggtaagatcctagtgaagaataaaaaaagacacaaagtggcagtaaaaggcccagaaggc
agtgtaaaaagaagggtcagcgaacaaacctccaatacttacagtgactcatccagtgtt
tgcgagtcttctgctacaggtctaccaccttcagaatcagctgatgtttcattgacactt
tccaatggggatgaaaaaatcgaggagaaaccccctaaatatacaaagccacggaaatcg
attgatcatgatgcttatagtgaggaggaagaagaagaagagccgtcagatcccaagaaa
tctgatgagggtacagcaagtagtgaggtgaatgccacagaggagatgtccacacttgtg
aattatgtagaacctgttaagttcaagtcatttgatgcggccaaaaaaagaaataagtat
tatgagatgtcctcatttgttgaaaccaaggcattggagcagctcactaaatccccaatg
gaatttgtggaatataacaagaagcagctcagccgtatttacccaaaaggaactcgggta
gattcctcaaattacatgccccagctcttctggaatgcaggatgtcaaatggtggctttg
aactttcaaacgctggatcttccaatgcagctgaatgtgggcatttttgagtataataga
cgcagtggttacctcctcaaaccggaattcatgtgcaggacagacaagcattttgatcct
tttactgaaaatatcgtcgatggaattgtcgcaaatacggttaaaatcaagattatatca
gggcagttcctatctgaaaagcgagtaggcatattcgtagaggtcgatatgtttggtctg
ccagttgataccaagaggaaatttcgcacaaaaacatcccaaggaaactcatttaatcct
gtctgggatgaagagccatttattttgcctaaggttgtactccccacacttgccactctc
cgcattgctgtctttgaagaaggtggaaagtttgtaggtcatcgaatcctgcctgtctca
gctatccgaccaggatatcactacatttgccttagaaatgagcttaaccagcctgtctgt
ctcccagcgctgcttgtttacactgaagtaaatgattatattcctgatgaccaccagggc
tatgcgaatgccttaactaaccccatcaagcacatcagcctcatggaccaaagggcaaag
caactggcagctctaatgggagagaatgagcaaccattcaacaaagacaagattgattgg
gatccaatatcaaagcccccaataagatcccgcgatgataccccagagaagattaaaata
cccattattcctgtgccttccccaccagcgcaacgagatgaccacattgccagtgtgctg
acagacatacaagccccctccatggaagagctgaaatctcaaaagagctttgagaaattg
atttgccgccagtaccgagaactgcgtcaactacgccgcaagcacctgcgcaaggtgtcg
tctctgtgcaaggagcagagcacttgggtgacacctctgcagagtcttcgcaggaggaag
ccatttggaagaagccatagaggagtgtctggggcagatcaggatgctgagcagaagtta
atggatatgcagcgggaccaacaaaaacgtctcctggaactaagggaaattcaacatgag
caggaacgcaaactgaaacacagccacttactgcaggctgttcagaagctccaggaagtg
gccatttcttatcattccactcaactcaagaagttaaaggaaatcaatgaaaaggagaag
aaagagctgcagaagatcctggacagaaaaagacataacagcattacagaggccaagtca
cgggagcggcagaaaaaggacgtggaactgacagaaattaacaggcggcacattaacgag
tccgtaagctccatacgaaggctggaagaggcccagaaaaggcgtcaggagaagctgcag
acggctcaccaggaaacattgcaaaggataaaggatgaggaaccaaagctgcaggcacag
ttagatgaagcatgccaggctgagttctgccagctaccccaagaagtccgccgttacctg
caggaagatggttgggttggaagtggttcaggtcccccctcatcttcgcacagcagccca
ccctcaatcacccggagctgggggtcggagtctggcgaaaaagattctcttcattccccg
ggagattcaagtgatgaagccaccaggctctga

DBGET integrated database retrieval system