KEGG   Xenopus laevis (African clawed frog): 397737Help
Entry
397737            CDS       T01010                                 

Gene name
cdc25c-a, cdc25, cdc25-3, xcdc25-3, xcdc25c
Definition
cell division cycle 25C (EC:3.1.3.48)
Orthology
K05867  
M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:xla04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:xla04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xla04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 572 aa AA seqDB search
MIKERVTPPFQASGGSGVVMAESHIISSEAPPKSNPGLNIRTNCRMILNLLREKDCSVTF
SPEQPLTPVTDLAVGFSNLSTFSGETPKRCLDLSNLGDETAPLPTESPDRMSSGKLESPK
TQFVQFDGLFTPDLAWKAKKCPKRNMNSVLPHLLCSTPSFKKASGGQRSLSNKENEGELF
KNPNCKPVALLLPQEVVDSQLSPTPENKVDISLDEDCEMNILGSPISADPPCLDGAHDDI
KMQNLDGFADFFSVDEEEMENPPGAVGNLSCSMAILLSGPLLNQDVEISNVNNISLNRSR
LYRSPSMPEKLDRPMLKRPVRPLNSETPVRVKRRRSTSSPLQPEEENCQPQRRGTSLKKT
LSLCDVDISSVLDEDCGHRQLIGDFSKVYALPTVTGRHQDLRYITGETLAALMHGDFNSL
VEKFFIIDCRYPYEYDGGHIKSAFNLHRQDEVTDYFLQQPLTPLMAQKRLIIIFHCEFSS
ERGPKMCRSLREEDRASNDYPSLYYPELYLLKGGYKDFFPEYKELCEPQSYCPMHHQDFR
EDLLKFRTKCKTSVGDRKRREPEFRLTGQRLG
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgattaaggagcgtgtaacacccccgttccaggcaagtggaggttctggtgtagtcatg
gcagagagtcacataatatcatcagaagcacccccaaagtccaacccaggtctgaatatc
cgtactaactgccgaatgattttgaacctgctgcgcgaaaaagattgctctgttacattt
tcaccggaacagcctttgacacctgtgactgaccttgctgttggatttagtaacctaagt
actttcagcggtgaaactcccaaacgctgcctggacttgtccaaccttggtgatgagact
gcaccattgccaacagagtctcctgatagaatgtcatcaggtaagctggagtctccaaag
acacaatttgtccagtttgatggcctatttacacctgatctcgcatggaaagcaaagaag
tgtccaaagagaaacatgaattctgttctgccacaccttctttgcagcactccaagtttt
aaaaaagcctcaggaggacagagaagcttgtccaataaagaaaatgagggtgagctgttt
aagaatccaaactgtaaacctgttgctttgctgctaccacaagaagtagttgattcacaa
ttatctccaacacctgagaacaaggtggatatctccctagatgaggattgtgaaatgaat
atcttgggatcccccataagtgctgatcccccttgtttggatggagcacatgatgacatc
aaaatgcaaaatcttgatggatttgcagattttttttctgttgacgaagaggagatggag
aatcctcctggagctgtcggtaacttgtcctgtagtatggcaattcttctgtcggggccc
cttctaaatcaagatgtagaaatcagcaatgtaaacaatatatctttaaacagaagccgc
ctttaccgctcaccttctatgccagagaaacttgacaggccaatgcttaaacgcccagtg
aggccgctaaacagtgaaacacccgtcagagtgaaaaggagacgtagtaccagcagcccc
cttcaacctgaggaagagaactgccaaccacagaggaggggtacttctcttaaaaagaca
ctttctctttgtgatgtggatatcagttcagttttggatgaagattgtggtcacagacaa
ctaattggagatttttcaaaggtttatgctttacccactgttactggccgacaccaggac
ctccgatacatcactggagagactctggcagccttaatgcatggagacttcaacagttta
gtggagaaattctttataatcgattgccgttatccttacgagtatgatggaggacacatc
aagagtgcatttaaccttcaccggcaagatgaggtaacggactactttctgcaacaacca
ctgaccccgttgatggcacagaagagattaattataatctttcattgcgagttctcttct
gaaagaggcccaaaaatgtgtcggtctctcagggaggaagacagagccagtaatgattac
ccaagcctctattacccagagctttatctccttaaaggcggttacaaggatttttttcct
gaatacaaggagctatgtgaaccgcagagttactgcccaatgcaccaccaagatttccgc
gaggacctgctgaaattccgaacaaaatgtaagacttctgttggcgatcgaaagaggagg
gaaccggaattccgtttgacagggcaaaggcttgggtga

DBGET integrated database retrieval system