KEGG   Xenopus laevis (African clawed frog): 397742Help
Entry
397742            CDS       T01010                                 

Gene name
ccnb1.2, ccnb, ccnb1
Definition
cyclin B1
Orthology
K05868  
cyclin B
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
FoxO signaling pathway
Cell cycle
Oocyte meiosis
p53 signaling pathway
Progesterone-mediated oocyte maturation
Module
Cell cycle - G2/M transition
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    397742 (ccnb1.2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    397742 (ccnb1.2)
   04114 Oocyte meiosis
    397742 (ccnb1.2)
   04115 p53 signaling pathway
    397742 (ccnb1.2)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    397742 (ccnb1.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 397 aa AA seqDB search
MSLRVTRNMLANAENNVKTTLAGKRVVATKPGLRPRTALGDIGNKAEVKVPTKKELKPAV
KAAKKAKPVDKLLEPLKVIEENVCPKPAQVEPSSPSPMETSGCLPDELCQAFSDVLIHVK
DVDADDDGNPMLCSEYVKDIYAYLRSLEDAQAVRQNYLHGQEVTGNMRAILIDWLVQVQM
KFRLLQETMFMTVGIIDRFLQEHPVPKNQLQLVGVTAMFLAAKYEEMYPPEIGDFTFVTD
HTYTKAQIRDMEMKILRVLKFAIGRPLPLHFLRRASKIGEVTAEQHSLAKYLMELVMVDY
DMVHFTPSQIAAASSCLSLKILNAGDWTPTLHHYMAYSEEDLVPVMQHMAKNIIKVNKGL
TKHLTVKNKYASSKQMKISTIPQLRSDVVVEMARPLM
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctacgagtcaccagaaacatgctggcaaatgcagaaaacaatgtgaaaaccact
ttggctggaaagagggttgttgctaccaaaccagggttgagacctcgtacagccttggga
gacattggaaacaaggcagaggtgaaagtgccaacaaaaaaggaattaaagccagcagta
aaagctgccaagaaggcaaaacctgttgacaaattgttggagcctcttaaagtgatagaa
gagaatgtttgccctaaacctgctcaggttgaacccagctcaccaagcccaatggaaaca
tctggttgcctccctgatgagctctgccaggctttctctgatgtcctcattcacgttaaa
gatgttgatgctgatgatgatggcaacccaatgctgtgcagtgaatatgtcaaggacatt
tatgcttacctgaggagccttgaggatgcacaagcagtcagacaaaactaccttcatgga
caggaagtcacaggcaacatgcgtgccattttgattgactggctggtccaggtgcaaatg
aaattccgtctactgcaggagacaatgttcatgactgttggcataattgaccgctttctg
caggaacatccagttcccaaaaaccagctacagcttgtgggggtcacggctatgttcctt
gctgctaaatatgaagagatgtacccaccagaaattggagactttacatttgtaactgat
cacacatacacaaaggctcaaattcgggacatggaaatgaagatacttagggtgctaaag
tttgcaattggccgacccttacccctgcactttcttcggagagcttctaaaattggagag
gtaactgctgaacagcatagtttagccaaatatttgatggaacttgtgatggtggattat
gatatggtacatttcacgccttcccaaatagcagctgcttcctcctgcttgtctctcaaa
atcttaaatgcaggtgactggaccccaacactccatcactatatggcttactctgaagaa
gatctagtccctgttatgcagcatatggccaagaacatcatcaaggtgaacaaaggacta
accaagcatctgactgttaagaacaagtatgctagcagcaaacaaatgaagatcagcacg
attccacagctgaggtcagatgttgttgtggaaatggcccgcccactcatgtga

DBGET integrated database retrieval system