KEGG   Xenopus laevis (African clawed frog): 397742Help
Entry
397742            CDS       T01010                                 

Gene name
ccnb1.2.S, ccnb, ccnb1, ccnb1.2
Definition
(RefSeq) cyclin B1 S homeolog
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04114  Oocyte meiosis
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04914  Progesterone-mediated oocyte maturation
Module
xla_M00693  Cell cycle - G2/M transition
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    397742 (ccnb1.2.S)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    397742 (ccnb1.2.S)
   04114 Oocyte meiosis
    397742 (ccnb1.2.S)
   04115 p53 signaling pathway
    397742 (ccnb1.2.S)
   04218 Cellular senescence
    397742 (ccnb1.2.S)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    397742 (ccnb1.2.S)
DNA replication proteins [BR:xla03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    397742 (ccnb1.2.S)
Chromosome [BR:xla03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    397742 (ccnb1.2.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 397742
NCBI-ProteinID: NP_001081266
Xenbase: XB-GENE-5736929
UniProt: P13350 A0A1L8GFW9
Position
4S
AA seq 397 aa AA seqDB search
MSLRVTRNMLANAENNVKTTLAGKRVVATKPGLRPRTALGDIGNKAEVKVPTKKELKPAV
KAAKKAKPVDKLLEPLKVIEENVCPKPAQVEPSSPSPMETSGCLPDELCQAFSDVLIHVK
DVDADDDGNPMLCSEYVKDIYAYLRSLEDAQAVRQNYLHGQEVTGNMRAILIDWLVQVQM
KFRLLQETMFMTVGIIDRFLQEHPVPKNQLQLVGVTAMFLAAKYEEMYPPEIGDFTFVTD
HTYTKAQIRDMEMKILRVLKFAIGRPLPLHFLRRASKIGEVTAEQHSLAKYLMELVMVDY
DMVHFTPSQIAAASSCLSLKILNAGDWTPTLHHYMAYSEEDLVPVMQHMAKNIIKVNKGL
TKHLTVKNKYASSKQMKISTIPQLRSDVVVEMARPLM
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctacgagtcaccagaaacatgctggcaaatgcagaaaacaatgtgaaaaccact
ttggctggaaagagggttgttgctaccaaaccagggttgagacctcgtacagccttggga
gacattggaaacaaggcagaggtgaaagtgccaacaaaaaaggaattaaagccagcagta
aaagctgccaagaaggcaaaacctgttgacaaattgttggagcctcttaaagtgatagaa
gagaatgtttgccctaaacctgctcaggttgaacccagctcaccaagcccaatggaaaca
tctggttgcctccctgatgagctctgccaggctttctctgatgtcctcattcacgttaaa
gatgttgatgctgatgatgatggcaacccaatgctgtgcagtgaatatgtcaaggacatt
tatgcttacctgaggagccttgaggatgcacaagcagtcagacaaaactaccttcatgga
caggaagtcacaggcaacatgcgtgccattttgattgactggctggtccaggtgcaaatg
aaattccgtctactgcaggagacaatgttcatgactgttggcataattgaccgctttctg
caggaacatccagttcccaaaaaccagctacagcttgtgggggtcacggctatgttcctt
gctgctaaatatgaagagatgtacccaccagaaattggagactttacatttgtaactgat
cacacatacacaaaggctcaaattcgggacatggaaatgaagatacttagggtgctaaag
tttgcaattggccgacccttacccctgcactttcttcggagagcttctaaaattggagag
gtaactgctgaacagcatagtttagccaaatatttgatggaacttgtgatggtggattat
gatatggtacatttcacgccttcccaaatagcagctgcttcctcctgcttgtctctcaaa
atcttaaatgcaggtgactggaccccaacactccatcactatatggcttactctgaagaa
gatctagtccctgttatgcagcatatggccaagaacatcatcaaggtgaacaaaggacta
accaagcatctgactgttaagaacaagtatgctagcagcaaacaaatgaagatcagcacg
attccacagctgaggtcagatgttgttgtggaaatggcccgcccactcatgtga

DBGET integrated database retrieval system