KEGG   Xenopus laevis (African clawed frog): 397767Help
Entry
397767            CDS       T01010                                 

Gene name
ppp1cc, ppp1cc-a, ppp1g
Definition
protein phosphatase 1, catalytic subunit, gamma isozyme (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
mRNA surveillance pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Focal adhesion
Regulation of actin cytoskeleton
Insulin signaling pathway
Herpes simplex infection
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:xla03015]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:xla04810]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:xla04114]
Cellular Processes; Cell communication; Focal adhesion [PATH:xla04510]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:xla04910]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:xla04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:xla04270]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:xla05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 323 aa AA seqDB search
MADVDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNASRPVTPPRGMITKQAKK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgttgacaagctaaacatcgacagcatcatacagcgactgttagaagttaga
ggatcaaaaccaggaaaaaatgtacaacttcaagagaatgagattcgagggctctgcctg
aagtctcgggaaatcttcctcagtcagccaatcttacttgagcttgaagcacctcttaaa
atatgtggcgacattcatggtcagtactatgacttacttcgactattcgaatatggtggc
ttcccacctgaaagcaactacctattcctaggagactatgtagaccgaggaaagcagtct
ttagaaaccatctgtctgcttttggcatacaaaatcaaatatccagagaacttcttcctc
ctcagaggcaatcatgaatgtgccagcattaaccgaatctatggcttttatgatgagtgc
aaaagaagatataatataaagttatggaaaaccttcacagattgctttaattgtttgcca
atagctgctatagtggacgagaagatcttttgctgtcatggaggcttgtctcccgatctt
cagtcgatggaacagatccgacgaattatgcggcctactgatgttccagaccagggtctt
ctgtgtgacttactttggtctgatcctgacaaagatgtcctagggtggggagaaaacgac
agaggtgtatcttttacttttggagctgaagtggttgcaaaatttcttcacaaacatgat
ctggatctcatctgcagagctcatcaggtggttgaagatgggtatgaattttttgccaag
agacaactggttactctgttctcagccccaaactattgtggggaatttgataatgctgga
gcaatgatgagtgtagatgaaacattaatgtgttccttccagattctaaaacctgcagag
aaaaagaagcctaatgcaagcagacccgtaacgccaccacgaggcatgatcacaaaacaa
gcaaagaaataa

DBGET integrated database retrieval system