KEGG   Xenopus laevis (African clawed frog): 397767Help
Entry
397767            CDS       T01010                                 

Gene name
ppp1cc, ppp1cc-a, ppp1g
Definition
protein phosphatase 1, catalytic subunit, gamma isozyme (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
mRNA surveillance pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Focal adhesion
Regulation of actin cytoskeleton
Insulin signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    397767 (ppp1cc)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    397767 (ppp1cc)
  Cell growth and death
   04114 Oocyte meiosis
    397767 (ppp1cc)
  Cellular commiunity
   04510 Focal adhesion
    397767 (ppp1cc)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    397767 (ppp1cc)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    397767 (ppp1cc)
   04270 Vascular smooth muscle contraction
    397767 (ppp1cc)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    397767 (ppp1cc)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     397767 (ppp1cc)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     397767 (ppp1cc)
Transcription machinery [BR:xla03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     397767 (ppp1cc)
Spliceosome [BR:xla03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    397767 (ppp1cc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 323 aa AA seqDB search
MADVDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNASRPVTPPRGMITKQAKK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgttgacaagctaaacatcgacagcatcatacagcgactgttagaagttaga
ggatcaaaaccaggaaaaaatgtacaacttcaagagaatgagattcgagggctctgcctg
aagtctcgggaaatcttcctcagtcagccaatcttacttgagcttgaagcacctcttaaa
atatgtggcgacattcatggtcagtactatgacttacttcgactattcgaatatggtggc
ttcccacctgaaagcaactacctattcctaggagactatgtagaccgaggaaagcagtct
ttagaaaccatctgtctgcttttggcatacaaaatcaaatatccagagaacttcttcctc
ctcagaggcaatcatgaatgtgccagcattaaccgaatctatggcttttatgatgagtgc
aaaagaagatataatataaagttatggaaaaccttcacagattgctttaattgtttgcca
atagctgctatagtggacgagaagatcttttgctgtcatggaggcttgtctcccgatctt
cagtcgatggaacagatccgacgaattatgcggcctactgatgttccagaccagggtctt
ctgtgtgacttactttggtctgatcctgacaaagatgtcctagggtggggagaaaacgac
agaggtgtatcttttacttttggagctgaagtggttgcaaaatttcttcacaaacatgat
ctggatctcatctgcagagctcatcaggtggttgaagatgggtatgaattttttgccaag
agacaactggttactctgttctcagccccaaactattgtggggaatttgataatgctgga
gcaatgatgagtgtagatgaaacattaatgtgttccttccagattctaaaacctgcagag
aaaaagaagcctaatgcaagcagacccgtaacgccaccacgaggcatgatcacaaaacaa
gcaaagaaataa

DBGET integrated database retrieval system