KEGG   Xenopus laevis (African clawed frog): 397771Help
Entry
397771            CDS       T01010                                 

Gene name
kras-b, k-ras, kras, rask2
Definition
(RefSeq) Kirsten rat sarcoma viral oncogene homolog
  KO
K07827  
GTPase KRas
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
VEGF signaling pathway
Tight junction
Gap junction
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    397771 (kras-b)
   04012 ErbB signaling pathway
    397771 (kras-b)
   04370 VEGF signaling pathway
    397771 (kras-b)
   04068 FoxO signaling pathway
    397771 (kras-b)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    397771 (kras-b)
  Cellular commiunity
   04530 Tight junction
    397771 (kras-b)
   04540 Gap junction
    397771 (kras-b)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    397771 (kras-b)
   04912 GnRH signaling pathway
    397771 (kras-b)
   04914 Progesterone-mediated oocyte maturation
    397771 (kras-b)
   04916 Melanogenesis
    397771 (kras-b)
  Development
   04320 Dorso-ventral axis formation
    397771 (kras-b)
GTP-binding proteins [BR:xla04031]
 Small (Monomeric) G-proteins
  Ras Family
   Ras [OT]
    397771 (kras-b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 186 aa AA seqDB search
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDVHHYREQINRVKDSDDVPMVLVGNKCDL
PSRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRKHKEKISNGKKKKSSK
RKCVVL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgacggagtacaaactggtggtggttggtgctggaggcgtggggaagagcgcactcaca
atccagctcattcagaaccattttgtggacgagtatgatcctactattgaggactcgtat
aggaagcaggtggtgatagacggggagacctgcctcctagatatcctggacactgcgggg
caagaggaatacagcgctatgagggatcagtacatgcgcacgggagaaggctttctctgt
gtctttgctattaacaacacaaagtccttcgaggacgtccatcattacagggaacagatt
aacagagttaaagattccgatgacgttcccatggtgttagttggtaacaaatgcgacctc
ccatcccggactgtggacacaaagcaagcgcaggaactggcaaagagctacggtattcct
tttatagagacctctgccaaaactagacagggagtcgaagacgccttctataccctagtc
cgtgaaatccgcaagcacaaggagaagatcagcaacgggaaaaagaaaaagtcctccaaa
aggaagtgtgtcgttctttaa

DBGET integrated database retrieval system