KEGG   Xenopus laevis (African clawed frog): 397771Help
Entry
397771            CDS       T01010                                 

Gene name
kras-b, k-ras, kras, rask2
Definition
Kirsten rat sarcoma viral oncogene homolog
Orthology
K07827  
GTPase KRas
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
VEGF signaling pathway
Tight junction
Gap junction
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    397771 (kras-b)
   04012 ErbB signaling pathway
    397771 (kras-b)
   04370 VEGF signaling pathway
    397771 (kras-b)
   04068 FoxO signaling pathway
    397771 (kras-b)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    397771 (kras-b)
  Cellular commiunity
   04530 Tight junction
    397771 (kras-b)
   04540 Gap junction
    397771 (kras-b)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    397771 (kras-b)
   04912 GnRH signaling pathway
    397771 (kras-b)
   04914 Progesterone-mediated oocyte maturation
    397771 (kras-b)
   04916 Melanogenesis
    397771 (kras-b)
  Development
   04320 Dorso-ventral axis formation
    397771 (kras-b)
GTP-binding proteins [BR:xla04031]
 Small (Monomeric) G-proteins
  Ras Family
   Ras [OT]
    397771 (kras-b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 186 aa AA seqDB search
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDVHHYREQINRVKDSDDVPMVLVGNKCDL
PSRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRKHKEKISNGKKKKSSK
RKCVVL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgacggagtacaaactggtggtggttggtgctggaggcgtggggaagagcgcactcaca
atccagctcattcagaaccattttgtggacgagtatgatcctactattgaggactcgtat
aggaagcaggtggtgatagacggggagacctgcctcctagatatcctggacactgcgggg
caagaggaatacagcgctatgagggatcagtacatgcgcacgggagaaggctttctctgt
gtctttgctattaacaacacaaagtccttcgaggacgtccatcattacagggaacagatt
aacagagttaaagattccgatgacgttcccatggtgttagttggtaacaaatgcgacctc
ccatcccggactgtggacacaaagcaagcgcaggaactggcaaagagctacggtattcct
tttatagagacctctgccaaaactagacagggagtcgaagacgccttctataccctagtc
cgtgaaatccgcaagcacaaggagaagatcagcaacgggaaaaagaaaaagtcctccaaa
aggaagtgtgtcgttctttaa

DBGET integrated database retrieval system