KEGG   Xenopus laevis (African clawed frog): 397785Help
Entry
397785            CDS       T01010                                 

Gene name
mapk1-b, Xp42, erk, erk2, ert1, mapk, mapk1b, mapk2, mpk1, p42mapk, prkm1, prkm2
Definition
mitogen-activated protein kinase 1 (EC:2.7.11.24)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Oocyte meiosis
mTOR signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Dorso-ventral axis formation
TGF-beta signaling pathway
VEGF signaling pathway
Focal adhesion
Adherens junction
Gap junction
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Salmonella infection
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    397785 (mapk1-b)
   04012 ErbB signaling pathway
    397785 (mapk1-b)
   04350 TGF-beta signaling pathway
    397785 (mapk1-b)
   04370 VEGF signaling pathway
    397785 (mapk1-b)
   04068 FoxO signaling pathway
    397785 (mapk1-b)
   04150 mTOR signaling pathway
    397785 (mapk1-b)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    397785 (mapk1-b)
  Cell growth and death
   04114 Oocyte meiosis
    397785 (mapk1-b)
  Cellular commiunity
   04510 Focal adhesion
    397785 (mapk1-b)
   04520 Adherens junction
    397785 (mapk1-b)
   04540 Gap junction
    397785 (mapk1-b)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    397785 (mapk1-b)
   04621 NOD-like receptor signaling pathway
    397785 (mapk1-b)
  Endocrine system
   04910 Insulin signaling pathway
    397785 (mapk1-b)
   04912 GnRH signaling pathway
    397785 (mapk1-b)
   04914 Progesterone-mediated oocyte maturation
    397785 (mapk1-b)
   04916 Melanogenesis
    397785 (mapk1-b)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    397785 (mapk1-b)
   04270 Vascular smooth muscle contraction
    397785 (mapk1-b)
  Development
   04320 Dorso-ventral axis formation
    397785 (mapk1-b)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    397785 (mapk1-b)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     397785 (mapk1-b)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   397785 (mapk1-b)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   397785 (mapk1-b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 361 aa AA seqDB search
MAAAAASSNPGGGPEMVRGQAFDVGPRYTNLSYIGEGAYGMVCSAHCNINKVRVAIKKIS
PFEHQTYCQRTLREIKILLRFKHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLK
TQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPD
HDHTGFLTEYVATRCYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQL
NHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADPKALDLLDKMLTFN
PHKRIEVEAALAHPYLEQYYDPSDEPVAEAPFKFEMELDDLPKETLKELIFEETARFQPG
Y
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggcagcggcctcgtctaaccccggcggaggtccggagatggtgcgagggcag
gcgttcgacgtaggcccgagatacaccaacctgtcatatatcggagagggagcgtacggc
atggtgtgttctgcccattgcaacattaacaaagtacgagttgctatcaagaaaatcagc
ccatttgagcatcagacatactgccagagaacattgagggagatcaaaatcttgctacgt
tttaagcatgaaaacatcattggaataaatgacattattcgagctccaaccattgagcag
atgaaagatgtgtacattgtgcaggacctcatggagacagatctctataaactcctgaag
actcagcatcttagcaatgaccatatctgctatttcttgtaccagattttgagaggatta
aagtacattcattcagccaacgttctacatcgtgatcttaagccttcaaatttgctgctt
aatactacctgtgatctcaagatttgtgattttggattggctcgtgttgcagatccagac
catgatcacactggctttctcacagaatatgtagccactcgctgttacagagctcctgag
atcatgctgaattccaagggctataccaaatcaattgacatctggtctgttggctgcatt
ctcgctgagatgctttctaatagaccaatatttccagggaaacattatctcgaccaactt
aatcacatactgggaattcttggatcgccatctcaagaagacctaaactgtataatcaat
ttaaaagctaggaattacttgctttcccttcctcacaaaaataaggtgccatggaaccga
cttttccccaatgcagatcccaaagctctagacttactggacaagatgctgacattcaac
ccacacaaaagaattgaagtagaggcagctttggctcatccttatctggagcagtattat
gacccaagtgatgagcctgtagctgaggctccctttaaatttgaaatggaactcgatgat
ttgcccaaggagacactgaaggagctaatttttgaagaaaccgctagattccagccaggg
tactga

DBGET integrated database retrieval system