KEGG   Xenopus laevis (African clawed frog): 397788Help
Entry
397788            CDS       T01010                                 

Gene name
arg2.L, arg1, arg2, arg2-a, arg2-b, arg2-c, arg3
Definition
(RefSeq) arginase 2 L homeolog
  KO
K01476  arginase [EC:3.5.3.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00220  Arginine biosynthesis
xla00330  Arginine and proline metabolism
xla01100  Metabolic pathways
xla01230  Biosynthesis of amino acids
Module
xla_M00029  Urea cycle
xla_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    397788 (arg2.L)
   00330 Arginine and proline metabolism
    397788 (arg2.L)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     397788 (arg2.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 397788
NCBI-ProteinID: NP_001081350
Xenbase: XB-GENE-864893
UniProt: A1A614
Position
2L
AA seq 360 aa AA seqDB search
MSIRSNFVRLLKKQVNIIKLQKKCSHSVAVIGAPFSKGQKRRGVEHGPAAIRSAGLIDRL
SNLGCNVCDFGDLHFSQVPNDEQYNRIVKHPRTVGLACKVLAKEVGKAVGAGHTCVTLGG
DHSLAFGSITGHAQQCPDLCVIWVDAHADINTPLTTPSGNLHGQPVSFLLRELQDKIPPI
PGFSWAKPCLSKSDIVYIGLRDLDPAEQFILKNYNISYYSMRHIDCMGIRKVMEKTFDQL
LGRRDRPIHLSFDIDAFDPALAPATGTPVIGGLTYREGVYITEEIHNTGMLSALDLVEVN
PVLATTSEEVKATANLAVDVIASCFGQTREGAHTRADTIIDVLPTPSTSYESDNEEQVRI
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtcaataagaagtaatttcgttaggctgctgaagaagcaagtcaatatcataaagctt
cagaagaaatgttcccactctgtggctgtgatcggggcacccttctccaagggacagaaa
agaagaggagtggagcatggacccgcagccataagaagtgccggtttaattgacagacta
tcgaatttaggatgcaatgtatgtgactttggagacttacacttttcccaagttcctaat
gatgaacagtacaaccgcattgttaaacatcctcgtactgtaggacttgcctgcaaggtg
ctggccaaagaagtgggcaaagcagtgggagccgggcatacctgcgtaaccttgggtgga
gatcacagtttggcttttggatctatcactggccatgcccagcagtgcccagacctctgt
gtaatttgggtggatgcccatgcagatattaacacgcctttgacaactccatcaggaaac
ctgcatggccagccagtgtcgttcctactgagggagcttcaggataagataccaccaatt
cctggtttttcttgggcaaagccgtgcctatcaaaatctgatattgtatacattggcttg
agagacctggatccagctgaacaatttattctaaagaattataatatctcatattactca
atgagacacattgattgcatgggcataaggaaagtcatggagaaaactttcgatcagctt
ctgggcaggagagatcggccaattcatttaagttttgacattgacgcttttgacccagcc
ttggcgccagctacaggaactcctgtcattggaggactgacttacagggaaggtgtctat
atcacagaggaaattcacaacacaggaatgttgtctgccttggatcttgtagaagtaaat
ccagttcttgcaaccacatcagaagaagtcaaagccactgcaaaccttgcagtggatgtc
attgcttcttgttttggccagacgagagagggagctcacactagagctgacactattata
gatgtcctacctacacccagcacatcatatgaatcagacaatgaagagcaagtgaggatt
tag

DBGET integrated database retrieval system