KEGG   Xenopus laevis (African clawed frog): 397788Help
Entry
397788            CDS       T01010                                 

Gene name
arg2-b, arg1, arg2, arg2-c, arg3
Definition
arginase 2 (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    397788 (arg2-b)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    397788 (arg2-b)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     397788 (arg2-b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 360 aa AA seqDB search
MSIRSNFVRLLKKQVNIIKLQKKCSHSVAVIGAPFSKGQKRRGVEHGPAAIRSAGLIDRL
SNLGCNVCDFGDLHFSQVPNDEQYNRIVKHPRTVGLACKVLAKEVGKAVGAGHTCVTLGG
DHSLAFGSITGHAQQCPDLCVIWVDAHADINTPLTTPSGNLHGQPVSFLLRELQDKIPPI
PGFSWAKPCLSKSDIVYIGLRDLDPAEQFILKNYNISYYSMRHIDCMGIRKVMEKTFDQL
LGRRDRPIHLSFDIDAFDPALAPATGTPVIGGLTYREGVYITEEIHNTGMLSALDLVEVN
PVLATTSEEVKATANLAVDVIASCFGQTREGAHTRADTIIDVLPTPSTSYESDNEEQVRI
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtcaataagaagtaatttcgttaggctgctgaagaagcaagtcaatatcataaagctt
cagaagaaatgttcccactctgtggctgtgatcggggcacccttctccaagggacagaaa
agaagaggagtggagcatggacccgcagccataagaagtgccggtttaattgacagacta
tcgaatttaggatgcaatgtatgtgactttggagacttacacttttcccaagttcctaat
gatgaacagtacaaccgcattgttaaacatcctcgtactgtaggacttgcctgcaaggtg
ctggccaaagaagtgggcaaagcagtgggagccgggcatacctgcgtaaccttgggtgga
gatcacagtttggcttttggatctatcactggccatgcccagcagtgcccagacctctgt
gtaatttgggtggatgcccatgcagatattaacacgcctttgacaactccatcaggaaac
ctgcatggccagccagtgtcgttcctactgagggagcttcaggataagataccaccaatt
cctggtttttcttgggcaaagccgtgcctatcaaaatctgatattgtatacattggcttg
agagacctggatccagctgaacaatttattctaaagaattataatatctcatattactca
atgagacacattgattgcatgggcataaggaaagtcatggagaaaactttcgatcagctt
ctgggcaggagagatcggccaattcatttaagttttgacattgacgcttttgacccagcc
ttggcgccagctacaggaactcctgtcattggaggactgacttacagggaaggtgtctat
atcacagaggaaattcacaacacaggaatgttgtctgccttggatcttgtagaagtaaat
ccagttcttgcaaccacatcagaagaagtcaaagccactgcaaaccttgcagtggatgtc
attgcttcttgttttggccagacgagagagggagctcacactagagctgacactattata
gatgtcctacctacacccagcacatcatatgaatcagacaatgaagagcaagtgaggatt
tag

DBGET integrated database retrieval system