KEGG   Xenopus laevis (African clawed frog): 397885Help
Entry
397885            CDS       T01010                                 

Gene name
Cyclin-A1, ccna1
Definition
cyclin A1
Orthology
K06627  
cyclin A
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    397885 (Cyclin-A1)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    397885 (Cyclin-A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 418 aa AA seqDB search
MRRSMASNGHILTASSVVGASSAFQNPCLAKVEVQPNLPQRTVLGVIGDNEQRRRSVSRG
GVPAKSLPGIENVLAFPGKILYANPAPVAPKPSFTVYVDEPTETYSVEVDCPSLDDEDSN
IVKQNIHLLLDISEASPMVVDTSPQTSPEDDSVTDPDAVAVSEYIHEIHQYLREAELKHR
PKAYYMRKQPDITSAMRTILVDWLVEVGEEYKLHTETLYLAMNYLDRFLSCMSVLRGKLQ
LVGTAAILLASKYEEIYPPDVDEFVYITDDTYSKKQLLRMEHVLLKVLAFDLTVPTVNQF
LLQYLQRHAVSVKTEHLAMYMAELTLLEVEPFLKYVPSLTAAAAYCLANYALNKVFWPET
LEAFTGYALSDIAPCLSDLHQFCLGAPYQAQQAIREKYKTTKYMQVSLLEMPSILPLN
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcagtatggcttccaatgggcacatccttacagcatcctctgtggtgggagcc
agcagtgcattccagaatccatgcctagccaaggtagaagtccagcctaacctgcctcaa
agaactgtgttgggtgttatcggtgacaatgaacagcgcagaagatcagttagtcggggt
ggtgtccctgcaaagagtctacctggaattgaaaatgttcttgctttccctggaaaaatc
ctgtatgcaaacccagcgcctgttgctccaaagccaagttttacagtctatgtggatgag
ccaacagaaacctattcagttgaagtagattgtcccagtttggatgatgaggattcaaat
attgtcaagcagaacattcacctgctcctagatatcagtgaagcttctccgatggtggtt
gacacgtcaccccagacaagcccagaggatgactctgtaacagaccctgatgctgtagct
gtgtctgaatatatacatgaaattcaccagtaccttcgagaggctgagttgaaacacaga
ccaaaggcatattacatgcgtaagcagccagacattacttcagcaatgcgcacgatactt
gtggactggctagtagaagttggtgaggaatacaagctgcacacggagactctttatctg
gctatgaattatttggaccgcttcctatcatgcatgtctgtactccggggaaaactgcag
cttgtaggcacagcagctattttattggcatcaaaatatgaagaaatctaccctcctgat
gttgatgaatttgtgtacataactgatgatacatactcaaagaaacagcttctgcgcatg
gaacacgttctgttgaaggttctggcctttgaccttactgtacctacagtcaaccaattc
ttgctacagtatctgcagagacatgcagtcagtgtgaagacggagcaccttgcaatgtac
atggcagaactaactctgcttgaagtggagccattcttgaagtacgttccttcacttaca
gctgctgcagcctattgtcttgccaattatgcactcaacaaagtgttctggcctgaaaca
ctggaagcctttactggctacgcactgagtgacatagcaccttgccttagtgatttgcac
caattctgtcttggtgccccttatcaggctcagcaagcaataagggagaagtacaagacc
accaagtatatgcaagtgtctcttctggagatgccgtcaatacttcccctcaactga

DBGET integrated database retrieval system