KEGG   Xenopus laevis (African clawed frog): 397924Help
Entry
397924            CDS       T01010                                 

Gene name
mos, c-mos, mosxe, msv, p39
Definition
v-mos Moloney murine sarcoma viral oncogene homolog (EC:2.7.11.1)
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    397924 (mos)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    397924 (mos)
  Cell growth and death
   04114 Oocyte meiosis
    397924 (mos)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    397924 (mos)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     397924 (mos)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: Other group
  MOS family
   397924 (mos)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 359 aa AA seqDB search
MPSPIPVERFLPRDLSPSIDLRPCSSPLELSHRKLPGGLPACSGRRRLLPPRLAWCSIDW
EQVLLLEPLGSGGFGSVYRATYRGETVALKKVKRSTKNSLASRQSFWAELNAARLRHPHV
VRVVAASASCPGDPGCPGTIIMEYTGTGTLHQRIYGRSPPLGAEICMRYARHVADGLRFL
HRDGVVHLDLKPANVLLAPGDLCKIGDFGCSQRLREGDEAAGGEPCCTQLRHVGGTYTHR
APELLKGEPVTAKADIYSFAITLWQMVSRELPYTGDRQCVLYAVVAYDLRPEMGPLFSHT
EEGRAARTIVQSCWAARPQERPNAEQLLERLEQECAMCTGGPPSCSPESNAPPPLGTGL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgccttccccaatccccgtggagcgtttcctgccgcgggacctgtccccgtccatagac
ctgaggccgtgcagcagtccgctggagctgagtcatcgcaagttaccgggcggtctcccc
gcctgtagcggccgccgccgcctcctccctccccgcctggcctggtgcagcattgactgg
gagcaggtgctgctgttggagccattgggttccggaggcttcggctcagtctaccgggcc
acgtacagaggggagacggtggcgctgaagaaggtaaaacgctccaccaagaacagtttg
gcttcccggcagagcttctgggccgaactgaacgcagcccgactccggcatccgcatgtg
gtgcgagtagtggccgccagcgcctcctgccccggggacccgggctgccccggcaccatc
atcatggaatacaccggcaccggaaccctccaccagcgcatatacgggcgctccccgccg
ctcggggccgagatctgcatgcgctatgcccgacacgtcgccgacggactgcgcttcctg
caccgggacggggtggtgcacctggatctgaagccggccaatgtgctgctcgccccgggg
gacctgtgtaagatcggcgacttcggctgctctcagaggctgcgcgagggggatgaggcc
gctggaggggaaccgtgttgcacccaactccgccacgtggggggaacctacactcaccga
gccccggagctgctcaagggagagcccgtcactgccaaagccgacatctactcgtttgct
atcaccctctggcagatggtgagccgggagctgccctacaccggggaccgacagtgcgtt
ctctatgcggtagtggcctatgatctacggccggagatgggcccgttgttcagtcacacg
gaggaaggcagagccgccaggaccattgtgcagagctgctgggctgcgcgacctcaggag
agacccaatgccgagcaactgctggagagactggagcaggaatgtgccatgtgcacgggg
ggacctccgtcctgcagccctgaatctaatgcaccccctcctctcggcactggtctatag

DBGET integrated database retrieval system