KEGG   Xenopus laevis (African clawed frog): 397925Help
Entry
397925            CDS       T01010                                 

Gene name
aurka, ARK-1, Eg2, aik, ark1, aur-a, aura, aurka-a, aurora2, btak, stk15, stk6, stk7
Definition
(RefSeq) aurora kinase A (EC:2.7.11.1)
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    397925 (aurka)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     397925 (aurka)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   397925 (aurka)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     397925 (aurka)
Chromosome [BR:xla03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    397925 (aurka)
  Spindle formation proteins
   397925 (aurka)
  Sister chromatid separation proteins
   Aurora kinases
    397925 (aurka)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 407 aa AA seqDB search
MERAVKENHKPSNVKIFHPMTEGAKRIPVNQPQSTQFRPPGTAVSAQRILGPSNVPQRVL
AQAQKPILSSQKPTTQIPLRPATQGHQSSKPQGPNENRNPQQTSHSSTPNVEKKGSTDQG
KTSAVPKEEGKKKQWCLEDFEIGRPLGKGKFGNVYLARERESKFILALKVLFKSQLEKAG
VEHQLRREVEIQSHLRHPNILRLYGYFHDASRVYLILDYAPGGELFRELQKCTRFDDQRS
AMYIKQLAEALLYCHSKKVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTLCGTL
DYLPPEMIEGRMHDETVDLWSLGVLCYEFLVGKPPFETDTHQETYRRISKVEFQYPPYVS
EEARDLVSKLLKHNPNHRLPLKGVLEHPWIIKNSQLKKKDEPLPGAQ
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggagcgggctgttaaggagaaccacaagccttctaatgtgaagatttttcaccccatg
actgagggagctaaacgtatcccagttaaccagccgcagagcactcagtttaggcctcct
gggactgcagtctctgcccagaggatattgggtccctctaatgtgccgcagcgagtgttg
gctcaggctcagaaacctattctgtccagtcagaagccaacgactcagatccccctgcgg
ccagcaactcaagggcatcagtccagcaaaccacagggaccaaatgagaatcgcaatcca
cagcagacaagccattcctccactccaaatgtggaaaagaaaggaagcaccgatcaagga
aaaacttcagctgttcccaaagaggagggcaaaaagaaacaatggtgcctggaagacttt
gaaatagggcggcccctgggcaaagggaagtttggaaatgtttatctggcacgcgagcgg
gagagtaaattcatcctggcgctgaaagtcctgtttaaatcccagctagagaaggcgggc
gtagagcaccagctacggcgggaggtggaaattcagtcccatctcaggcaccccaatatt
ctccggctctatggctatttccacgatgcttccagagtctacctaatcctggattatgcc
cctggtggggagttgttcagagagctgcagaaatgcacaagatttgatgatcagagaagt
gccatgtacatcaaacagctggcagaagccctcctgtactgtcactccaagaaggtgata
cacagggacatcaagccagagaacttgctgcttggctccaatggagaactgaagatcgcc
gactttggctggtctgtgcatgctccatcctccaggaggaccactctgtgtggaacactg
gactatctacctcctgagatgatcgagggcagaatgcatgatgagacggtggacttgtgg
agtctgggagttctctgttacgaattcctcgtagggaaacctccgtttgagactgacacc
caccaggaaacctacagacgtatttcaaaggttgaatttcaatatccgccatatgtatcg
gaagaggcaagagatcttgtctcaaagctgttaaagcacaacccaaaccacaggctgcca
ctgaaaggggttctcgaacatccatggatcataaaaaattctcaactcaagaagaaagac
gagccccttccaggcgcccaatag

DBGET integrated database retrieval system