KEGG   Xenopus laevis (African clawed frog): 397925Help
Entry
397925            CDS       T01010                                 

Gene name
aurka, ARK-1, Eg2, aik, ark1, aur-a, aura, aurka-a, aurora2, btak, stk15, stk6, stk7
Definition
aurora kinase A (EC:2.7.11.1)
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Oocyte meiosis
Class
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:xla04114]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 407 aa AA seqDB search
MERAVKENHKPSNVKIFHPMTEGAKRIPVNQPQSTQFRPPGTAVSAQRILGPSNVPQRVL
AQAQKPILSSQKPTTQIPLRPATQGHQSSKPQGPNENRNPQQTSHSSTPNVEKKGSTDQG
KTSAVPKEEGKKKQWCLEDFEIGRPLGKGKFGNVYLARERESKFILALKVLFKSQLEKAG
VEHQLRREVEIQSHLRHPNILRLYGYFHDASRVYLILDYAPGGELFRELQKCTRFDDQRS
AMYIKQLAEALLYCHSKKVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTLCGTL
DYLPPEMIEGRMHDETVDLWSLGVLCYEFLVGKPPFETDTHQETYRRISKVEFQYPPYVS
EEARDLVSKLLKHNPNHRLPLKGVLEHPWIIKNSQLKKKDEPLPGAQ
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggagcgggctgttaaggagaaccacaagccttctaatgtgaagatttttcaccccatg
actgagggagctaaacgtatcccagttaaccagccgcagagcactcagtttaggcctcct
gggactgcagtctctgcccagaggatattgggtccctctaatgtgccgcagcgagtgttg
gctcaggctcagaaacctattctgtccagtcagaagccaacgactcagatccccctgcgg
ccagcaactcaagggcatcagtccagcaaaccacagggaccaaatgagaatcgcaatcca
cagcagacaagccattcctccactccaaatgtggaaaagaaaggaagcaccgatcaagga
aaaacttcagctgttcccaaagaggagggcaaaaagaaacaatggtgcctggaagacttt
gaaatagggcggcccctgggcaaagggaagtttggaaatgtttatctggcacgcgagcgg
gagagtaaattcatcctggcgctgaaagtcctgtttaaatcccagctagagaaggcgggc
gtagagcaccagctacggcgggaggtggaaattcagtcccatctcaggcaccccaatatt
ctccggctctatggctatttccacgatgcttccagagtctacctaatcctggattatgcc
cctggtggggagttgttcagagagctgcagaaatgcacaagatttgatgatcagagaagt
gccatgtacatcaaacagctggcagaagccctcctgtactgtcactccaagaaggtgata
cacagggacatcaagccagagaacttgctgcttggctccaatggagaactgaagatcgcc
gactttggctggtctgtgcatgctccatcctccaggaggaccactctgtgtggaacactg
gactatctacctcctgagatgatcgagggcagaatgcatgatgagacggtggacttgtgg
agtctgggagttctctgttacgaattcctcgtagggaaacctccgtttgagactgacacc
caccaggaaacctacagacgtatttcaaaggttgaatttcaatatccgccatatgtatcg
gaagaggcaagagatcttgtctcaaagctgttaaagcacaacccaaaccacaggctgcca
ctgaaaggggttctcgaacatccatggatcataaaaaattctcaactcaagaagaaagac
gagccccttccaggcgcccaatag

DBGET integrated database retrieval system