KEGG   Xenopus laevis (African clawed frog): 397943Help
Entry
397943            CDS       T01010                                 

Gene name
thbs4
Definition
thrombospondin-4
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:xla04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:xla04145]
Cellular Processes; Cell communication; Focal adhesion [PATH:xla04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 955 aa AA seqDB search
MPRRKGLCLFLQMLLLHLYGVCQAQPNYQVFDLLSVSVQRQVTSFLQSALSNPSMNEVYV
LSTFKLQPKSTVTLFGLYSTSDNSRFFEFTVMGRLNKASLRYLRSDGKLHSVFFNKLDIA
DGKQHALLLHLSGLHRGATFAKLYIDCNPTGVVEDLPRPLSGIRLNTGSVHLRTLQKKGQ
DSMDELKLVMGGTLSEVGAIQECFMQKSEAGQQTGDVSRQLIGQITQMNQMLGELRDVMR
QQVKETMFLRNTIAECQACGLGPDFPLPTKVPQRLATTTPPKPRCDATSCFRGVRCIDTE
GGFQCGPCPEGYTGNGVICTDVDECRLNPCFLGVRCINTSPGFKCESCPPGYTGSTIQGI
GINFAKQNKQVCTDTNECENGRNGGCTSNSLCINTMGSFRCGGCKPGYVGDQIKGCKPEK
SCRHGQNPCHASAQCSEEKDGDVTCTCSVGWAGNGYLCGKDTDIDGYPDEALPCPDKNCK
KDNCVYVPNSGQEDTDKDNIGDACDEDADGDGILNEQDNCVLAANIDQKNSDQDIFGDAC
DNCRLTLNNDQRDTDNDGKGDACDDDMDGDGIKNILDNCQRVPNVDQKDKDGDGVGDICD
SCPDIINPNQSDIDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSNQLDTDKDGIGDEC
DDDDDNDGIPDTVPPGPDNCKLVPNPGQEDDNNDGVGDVCEADFDQDTVIDRIDVCPENA
EITLTDFRAYQTVVLDPEGDAQIDPNWIVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEG
TFHVNTMTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVKSKS
GPGEHLRNALWHTGDTNDQVRLLWKDPRNVGWKDKVSYRWFLQHRPQVGYIRARFYEGTE
LVADSGVTVDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQAFQAQQFSS
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atgcctagacgaaaaggcttgtgtctattcctacagatgttacttcttcatctttatgga
gtgtgtcaagcccagccaaattatcaagtcttcgatcttctatccgtgtcggttcaaagg
caggtcacctctttccttcaaagcgcactgagcaatccttccatgaatgaggtgtatgtc
ttgtcaactttcaaactgcagcccaagtccacagttacgctctttggactttattccacc
agtgacaacagcaggttctttgaattcacagttatgggtcgtttaaacaaagcctcttta
cgatacctccggagtgatgggaagttacactcagtcttctttaataagcttgacatagct
gatgggaagcagcacgcgcttctgttgcacctgagcggcttacaccggggcgcaacgttt
gcaaagctctacatagactgtaatccgacaggtgttgttgaagatctaccccggccgtta
tcagggataaggctcaacacagggtctgtgcacttaagaacactacagaaaaagggacag
gattccatggatgaattaaaactggtaatgggaggcactctgtccgaggtaggagcaata
caagaatgttttatgcagaaaagtgaagccggacagcagacaggtgacgtcagcagacag
ttgattggccagataacccaaatgaatcagatgctgggagagctccgagatgtcatgaga
cagcaggtgaaagagaccatgttcttgagaaacaccattgcagaatgccaggcctgtggc
ttaggtcctgacttcccattgccaaccaaagttccccagcgcctagccaccactacacct
ccaaagcctcgatgtgatgcaacttcatgtttcagaggagtgcggtgcattgatacagag
ggcggcttccaatgtgggccgtgtcctgaaggctatacaggcaacggtgtcatttgtact
gatgtggatgagtgtcggttgaatccatgtttccttggtgtacgttgcataaacacttct
ccgggtttcaaatgtgagagctgccctcccgggtacactggatccacaattcaagggatt
ggcattaactttgccaagcaaaataagcaggtttgcacagataccaatgaatgtgaaaat
ggaagaaatggagggtgtacatccaattctctttgcatcaatacgatgggatctttccgc
tgtgggggctgcaaacctggttatgtcggggatcaaataaaaggctgcaaacctgaaaaa
agctgccgtcatggacagaatccgtgtcatgcaagtgctcagtgttcagaggaaaaggac
ggtgacgtaacctgcacttgttcagtcggttgggccggcaatggctacctctgtggcaaa
gatactgatattgatggctacccggatgaagccctgccatgtccagataagaactgcaaa
aaggacaactgtgtatatgttcctaactcgggtcaagaagacactgataaagataacatt
ggagatgcttgtgatgaagatgcggatggagatggtatcctaaatgagcaggacaactgt
gtgctggctgccaacatcgatcagaaaaacagtgaccaagatatatttggggacgcctgt
gacaactgccgcttaaccctcaacaatgaccaaagggacacagacaatgacgggaaagga
gatgcttgtgacgatgacatggatggagatggcatcaagaatatcttggataactgccag
agagttcccaatgtggaccagaaagacaaagatggagatggagttggtgatatatgtgac
agctgtcctgacatcataaatccaaaccagtcagacattgacaatgaccttgttggagat
tcctgtgatactaaccaagacagcgatggtgatggtcaccaggacagcacagacaactgc
cccacagtgataaacagcaaccagctcgacacagacaaggacggcatcggagatgaatgt
gacgatgatgatgataacgatggaatcccggatactgttcctcccggacctgataactgt
aaactggttcccaacccagggcaggaggatgacaacaatgatggagtcggagacgtctgt
gaggccgattttgaccaggacacggtcattgaccgaattgacgtttgccctgaaaatgca
gagatcaccctgacagatttcagagcttatcaaactgtagttctggatcccgaaggagat
gcccaaattgatccaaactggattgttttgaaccagggaatggagattgtgcagacgatg
aacagtgaccctggactggcagttggttacacagcatttaatggagttgatttcgagggc
acattccacgtgaacaccatgacggatgatgattacgctggtttcatctttggttatcag
gacagttcaagcttttatgtggtgatgtggaagcagactgagcagacttactggcaggca
acccccttcagagcagttgcagagcctggaatccaactgaaggctgtgaaatccaagtca
ggacccggggaacatctgaggaacgctctgtggcacacaggagacaccaatgatcaagtg
aggctgctctggaaagaccccaggaatgtcggctggaaagacaaagtctcctaccgctgg
ttcttacagcacaggccacaagtcggctacatcagagccagattttatgaaggcaccgag
ctggtggctgactctggagtcactgtggacaccaccatgcgaggaggaagactgggagta
ttctgcttttcacaggaaaacataatttggtccaatctgaaataccggtgtaatgataca
atcccagaggatttccaggcatttcaagcacaacagttttccagttaa

DBGET integrated database retrieval system