KEGG   Xenopus laevis (African clawed frog): 398021Help
Entry
398021            CDS       T01010                                 

Gene name
ncoa3, actr, aib-1, aib1, bHLHe42, cagh16, ctg26, kat13b, pcip, rac3, src-3, src3, tnrc14, tnrc16, tram-1, xSRC-3
Definition
nuclear receptor coactivator 3 (EC:2.3.1.48)
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
xla  Xenopus laevis (African clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 1391 aa AA seqDB search
MSGLGENSLDPLASETRKRKPSSCDTPGPGLTCSGEKRRREQESKYIEELADLISANLSD
IDNFNVKPDKCAILKETVRQIRQIKEQGKASSNDDDVQKADVSSTGQGVIDKDSLGPLLL
QALDGFLYVVNREGSIVFVSENVTQYLQYKQEDLVNTSVYSILHEEDRKDFLKNLPKSTV
NGVPWFSETPRQKSHTFNCRMLVKTSHDHLEDGSNLDARQRYETMQCFALSQPRAMIEEG
EDLQSCMICVARRITTAERAFSANPESFITRHDLTGKVVNIDANSLRSSMRPGFEDTIRR
CIQRFLFHSEGQPWTYKRHYQEAYVHGLSETPLYRFSLADGTMVTAQTKSKLFRNPVTND
PHGFVSTHFLQREQNGYRPNPNPMAQGIRPQMNPNLPNTMNSMPPQAMQQQNRNYGMGDP
NSMAQMQGMRYKSPGNMAPVNQAPGVQQSPYQNNSNYGLNMNSPPHGSPGMNANQPNLMV
SPRNRASPKMASNQFSPVPGMNSPMGSSGNAGGGSFSSSSLSALHAISEGVGSSLLSSLS
SPGQKVENNSNMNMPQQGKICNQDCKSPSGLYCEQGQVESSVCQSSGREHLGEKDVKENI
FEGSESQRSQAESKGHKKLLQLLTCFTEERGQSLMSSSSMDCKDSSNVTSPSGVSSSTSI
GVSSTSNLHGSMLQEKHRILHKLLQNGNSPAEVAKITAEATGKDVFQETVSSAPCTEATV
KREQLSPKKKENNALLRHLLDKDDWKDPLAKDIKPKVEHMDIKMGSCSSSNVPTSSQDKE
VKIKTEPGEEVPGDLDNLDAILGDLAGSDFYSNSMSSRASDLGPKQPVFQDSPTLAMRSP
DSMQGSRPPFNRAMSLDSRSSTPPVRNVNSFPMLPKQGMIGSPRMMDGQDNFGVMMGSGP
NRSMNQHPGGDWAMQNSAVNRLEPPNVGSVGRPGPDYSSAMTRPAMGGNMPGLLTRSNSI
PGSRPVMQQQQHILPMRPNDMAMSMGSNPYGQQAPSNPPGSWPDAIMMNQGRGGAQNRQL
GRNSLDDLLCPPSTVEGQTDEIALLDQLHTLLSNTDATGLEEIDRALGIPDLVSQGQALE
PQPDSYQPQGSPVMIDQKPPMYGQHYAGQGAAMSAGGFNNMQGQHPPFNTVMGQMNQQQG
MHPLQGMHPRANLIRPRNNIPKQLRMQLQQRLQGQQFLNQNRQALEMKVDPMNPGGAGVM
RPVMQTPVSQQGFLNAQMVAQKNRELISHQIRQHRMAMMMQQQQGQPQAFSPPPNVTASA
SMDNPLGGPPMPQAPPQQFSYPPNYGINQQTDPTFGRVSSPPNAMMSSRMAPSQNPHPQT
TQMYPSPDMKGWPSGNMARPNSFPQQQYSHQTNPATYNMMHMNGNGNHMGQMNINSLPMS
GMPMGPDQKYC
NT seq 4176 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattaggggaaaactccttggatccgctggcgtctgaaacaagaaagcgcaag
ccgtcttcctgtgatacccccggacctggtctgacctgcagtggtgagaagaggaggcgt
gagcaggagagcaagtacatagaggagttggccgatctcatttcagccaatcttagcgac
atagacaatttcaatgtcaaaccggacaaatgcgcgatcttaaaggagacggtcaggcag
atccgtcagattaaagagcaaggaaaagcctcttctaatgacgacgatgtgcagaaagcc
gatgtttcctctacagggcagggggtgattgataaggattctctcgggccgctgttattg
caggctctggatggctttctgtatgtggtgaatcgagagggcagcattgtatttgtatct
gaaaatgtcacccagtacttacaatacaaacaagaggatctggttaacactagtgtctac
agcattctgcacgaagaggaccgtaaagatttcctcaagaacctgcccaaatctactgtt
aatggcgtcccatggtttagtgaaacccctcgacagaagagccacacgttcaactgccgc
atgctggtcaaaacctctcatgatcatctggaggacggaagcaacctggacgcgcgtcag
agatacgagaccatgcagtgctttgctttatctcagccccgggcgatgatcgaggaggga
gaagaccttcagtcctgtatgatctgtgtggccaggcgcatcacaactgcagagagggcc
ttctcagccaatcctgaaagcttcatcacaaggcacgatctgaccggcaaggtggtgaac
attgatgccaactccctgcgttcctccatgagaccgggctttgaagatacgatccgtaga
tgtattcaaaggttcctgtttcacagcgaagggcagccatggacctacaaacgccattac
caagaagcctatgtccacggactttctgaaacgcctctgtataggttctctctagcagat
ggcaccatggtgactgctcagacaaaaagtaagctcttccggaatcctgtcaccaatgat
ccgcacggctttgtctccacgcatttcttgcaaagggaacagaatggctaccgacccaat
ccgaacccaatggctcaaggtattcggccacaaatgaaccctaacctacccaatacaatg
aattcaatgccaccgcaggccatgcagcagcagaacaggaactatggcatgggggacccc
aacagcatggcacaaatgcagggcatgagatacaagtccccaggcaacatggcacctgtt
aatcaagctccaggggtacagcagtctccgtaccagaacaatagtaattatggccttaac
atgaacagcccaccgcatggcagtccgggcatgaatgccaaccaacccaaccttatggtg
tcacccagaaaccgggccagtcccaagatggcatccaatcagttttctcctgttccaggc
atgaactctccaatgggatcttcaggaaatgcagggggaggtagcttctctagcagctcg
ctaagtgctctccatgccataagcgaaggagtggggagttcactcctgtcatcattatct
tctcctggccagaaagtagagaacaattccaatatgaacatgccccagcagggtaaaatt
tgcaaccaggattgtaagagtcccagtggcttgtactgtgaacaaggacaagtggaaagc
tctgtgtgtcagtcaagcggtagggagcaccttggtgaaaaagacgttaaagagaacata
tttgaagggtcggagagtcagagatcacaagctgaaagtaaagggcataagaagctcctt
cagcttctcacatgttttacagaagagaggggtcaaagtctaatgtctagttcttctatg
gactgcaaagactcatccaatgtaacaagtccatcaggggtgtcctcatccacttccatc
ggggtcagctctacgtccaacttgcatggctccatgcttcaagaaaaacaccgcattctc
cataagttgctgcaaaatggcaactcccctgcagaagtagcaaagatcacagcagaagcc
accggaaaggacgttttccaggaaaccgtgagctccgcaccttgcacggaagcaacggtg
aaacgagagcagctgagcccaaagaagaaggagaacaatgcacttctgaggcatttgctg
gacaaagacgactggaaggacccactggccaaggacattaaacccaaagtggaacacatg
gacattaaaatgggctcgtgtagtagttccaatgtcccgacttcaagtcaggataaagag
gttaaaataaagacagagcctggagaagaggttccgggagatttggataatttggatgct
atcctgggagatctggctggttctgacttctattccaattcaatgagttccagagcaagc
gaccttgggcccaagcagcctgtattccaggacagcccaacattggccatgaggagtcct
gatagcatgcaggggagccggccgccatttaatcgggcaatgtccctagacagcagaagc
tccacccctccagtgcgaaacgttaacagttttccgatgctgccaaagcaaggcatgata
ggaagcccgagaatgatggatggtcaagacaattttggcgttatgatggggagtggacct
aacaggagtatgaaccaacatccaggtggggactgggctatgcagaactccgcagtcaat
aggttggagcctcctaacgtggggagcgttggccggccagggccagattacagttccgca
atgacgaggcctgcaatgggcgggaatatgccaggacttcttaccagatctaacagtatt
cctgggagcagaccggtgatgcagcagcagcagcatattcttccaatgaggcccaacgac
atggcgatgagcatgggatcaaatccttatggacaacaagctccttcaaatccgcctgga
tcgtggcccgatgcaataatgatgaaccagggtcgtggtggtgcacagaacagacagtta
ggaaggaattctttggacgacctcctatgtcctccttcaactgttgaagggcagacagat
gaaattgcgctcctcgatcagttgcacacccttctcagtaacacagacgccacaggactg
gaagaaatagaccgagctctgggaattccggacttggtcagtcagggtcaagctctggag
ccacagccagattcttaccagcctcaaggctctccagtcatgatcgatcagaagccaccc
atgtatggccagcactatgcaggacagggagctgctatgtctgctggcggctttaataac
atgcaggggcagcacccaccctttaatacggtgatgggtcagatgaaccagcagcaaggc
atgcacccactgcaaggtatgcacccacgggccaacctcattagaccccgaaacaacata
cccaaacagctgagaatgcaactgcagcagaggcttcaggggcagcagttcctgaaccaa
aaccgacaagccttagagatgaaggtggacccaatgaatccaggtggagctggagttatg
aggcccgtgatgcaaacacccgtctcacagcagggctttctcaacgcacagatggtggca
cagaagaacagggaactgattagccaccaaatcagacagcacagaatggccatgatgatg
caacagcagcaagggcaacctcaagccttcagccctcctcccaatgtgactgcctcggcc
agtatggataacccactaggagggccaccaatgccccaggctcctcctcagcaattctcc
taccctcctaattatggtatcaatcagcagactgaccccacttttggaagggtgtctagc
ccacctaatgccatgatgtcatctcggatggctccttcccagaatcctcaccctcagacc
acacaaatgtatccatcaccagacatgaaaggctggccatcagggaatatggctagacca
aattccttcccacagcagcagtacagccaccagactaaccctgccacgtataacatgatg
cacatgaacggcaacgggaatcacatgggccagatgaatatcaactcgttgcctatgtct
ggaatgcctatgggtcctgatcagaaatattgctga

DBGET integrated database retrieval system