KEGG   Xenopus laevis (African clawed frog): 398022Help
Entry
398022            CDS       T01010                                 

Gene name
igf1r.S, XTK2, igf-1r, igf1r, xigf1r
Definition
(RefSeq) insulin like growth factor 1 receptor S homeolog
  KO
K05087  
insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
FoxO signaling pathway
Oocyte meiosis
Autophagy - animal
Endocytosis
mTOR signaling pathway
Focal adhesion
Adherens junction
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    398022 (igf1r.S)
   04150 mTOR signaling pathway
    398022 (igf1r.S)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    398022 (igf1r.S)
   04140 Autophagy - animal
    398022 (igf1r.S)
  Cell growth and death
   04114 Oocyte meiosis
    398022 (igf1r.S)
  Cellular community - eukaryotes
   04510 Focal adhesion
    398022 (igf1r.S)
   04520 Adherens junction
    398022 (igf1r.S)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    398022 (igf1r.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     398022 (igf1r.S)
Protein kinases [BR:xla01001]
 Tyrosine protein kinases
  InsR family [OT]
   398022 (igf1r.S)
Enzyme-linked receptors [BR:xla01020]
 Receptor tyrosine kinases
  RTK class II (Insulin receptor family)
   398022 (igf1r.S)
Cytokine receptors [BR:xla04050]
 Receptor tyrosine kinase
  RTK class II (Insulin receptor family)
   398022 (igf1r.S)
Cellular antigens [BR:xla04090]
 Proteins
  398022 (igf1r.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
3S
AA seq 1358 aa AA seqDB search
MKAELVPVCTAWILGLLLCLGPAAAKVCGPNMDIRNDVSELKQLRDCVVIEGYLQILLIS
NAKAEDFRNLRFPNLTVITDYLLLFRVSGLVSLSNLFPNLTVIRGRVLFYNYALVIFEMT
DLKEIGLYNLRNITRGAVRIEKNSELCYVSTVDWSLVLDAVYNNYIVGNKPPKECVDLCP
GAREKMQICEKSSINNEFADRCWSDEHCQKVCPSVCGKRACSDNNECCHPECLGSCTAPD
NDTACVACHHYFYEGRCVPTCPSNTYKFEGWRCITREVCAKMHIWIHSTIPFIIHKGECV
YECPSGYMLNKSQSMTCSPCEGPCPKICEEKMKTIDSVTSAQMLEGCTVLKGNLQLNIRK
GQNIAAELENFLGLIETVTGYVKIRHSHALVSLSFLKSLRYILGEEQMPGNYSFYVFDNN
NLQQLWDWSKHNLTIKEGKIRFAFNSKLCASEIYRMEEVTGTKGRQAEEDISLSTNGNMA
SCESHVLNFTSRSKIKNRIKLTWERYRPPDYRDLISFTVYYKEAPFRNVTEYDGQDACGS
NSWNMVDVDLPASKESDPGILLQGLKPWTQYAIYVKAITLTMLENRHIHGAKSKIIYMRT
DAAVPSIPQDMISASNSSSQLVVKWNPPSLPNGNLSYYIVRWQQQPQDRHLYQYNYCFKD
KVPNRKYANGTIDTEGGTEPTKPEGSVGEKGHYCACPKTEAEEKAEKDEAEYRKVFENFL
HNSIFVPRPNRRRRDVLAVGNSTVTSYEKNSTTEDFSNFSDSERDDIEYPFYETKVDYKW
ERTVISNLQPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAAGADDIPGIVNTKEEDD
GVIFLGWPEPLRPNGLILMYEIEYKHQGEVHRECVSRQDYRKNGGIKLVRLPPGNYSAQV
QAISLYGNGSWTEMVSFCVKLKPDVRNNILQMVVAIPLALSFLLVGIISIVCFVFKKRNS
NRLGNGVLYASVNPEYFSAAEMYVPDKWEVPREKITMNRELGQGSFGMVYEGIAKGVVKD
EAETKVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTR
GDLKSYLRSLRPDTESNSGQPTPSLKKMIQMAGEIADGMSYLNANKFVHRDLAARNCMVT
EDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWE
IATLAEQPYQGMSNEQVLRFVMEGGLLEKPDNCPDMLFELMRMCWQFNPKMRPSFLEIIS
SIKDELDPGFKEVSFFYSEENKPPDTEELDLEAENMESIPLDPSCALQNSEHHAGHKSEN
GPGVVVLRASFDERQPYAHMNGGRKNERALPLPQSSAC
NT seq 4077 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgaattggtgcctgtttgtacggcctggatcctggggctcctcctgtgtctg
ggaccagcggctgccaaagtgtgtggtcccaacatggacatccgaaatgacgtcagtgag
cttaaacagctgagagattgtgtcgtgatcgaaggctacctgcaaattctgctcatctca
aatgccaaggcagaggacttccggaaccttcggttccccaatttgaccgttatcactgac
tatttattgcttttccgggtttctggcttggtgagtctcagcaatctctttcccaacctc
actgtgatccgtggccgagtcctcttctacaactacgcccttgttatctttgagatgacc
gacctcaaggagattggattgtacaacttgcgtaacataacacgtggcgccgtcaggatc
gagaagaactcggaactgtgttatgtgtccacggtggactggtcgcttgttctggatgcc
gtctacaacaactacattgttgggaataagccaccgaaggagtgtgtggatttgtgtcct
ggagctagagagaaaatgcaaatttgtgaaaagtcatccataaataatgaatttgccgac
cgatgttggtcggatgagcactgccaaaaagtctgtcccagtgtttgtggcaagcgagcg
tgttctgataacaacgaatgctgtcatccagaatgcttgggcagctgcacggctcccgat
aacgatacagcttgtgtggcctgtcaccactacttctacgagggccgctgtgtcccgacc
tgcccgtctaacacctataaatttgaagggtggcgctgcatcactcgggaagtatgtgcc
aagatgcatatctggatacacagcacaattccattcatcattcacaaaggagaatgtgta
tacgagtgcccatcaggatacatgctgaataaaagccagagcatgacctgcagcccctgc
gagggtccctgccccaaaatatgtgaagagaagatgaaaaccattgattctgttacctca
gcccaaatgctggaaggttgtactgtcctgaagggcaacctgcaactaaatatccgcaag
ggtcaaaatattgctgcagagttggagaatttcttgggtctgatagagacagtcactggc
tatgtcaagattcgtcactcccatgcactggtatctctgtctttcctgaaaagtctgcgc
tacatcctgggagaggagcaaatgcctggaaattattccttttacgtctttgacaataac
aacttacagcagctgtgggactggtcgaagcacaacctcaccatcaaagagggcaaaata
cgctttgcattcaactccaagctatgcgcttctgagatttaccgcatggaggaagtcacc
ggaacaaaggggaggcaggctgaagaagacatcagcctcagtactaatggaaatatggca
tcttgtgagagtcatgtcttaaatttcacctccaggagcaaaattaagaaccggattaag
cttacttgggagcgttacaggccacctgattacagagaccttatcagcttcactgtctac
tacaaagaggcaccattccgtaatgtaacagagtatgatggtcaggatgcatgcggatcc
aacagctggaatatggtggacgtagacctcccggctagcaaggaaagtgaccctggaatc
ctcctgcagggacttaagccttggacacaatatgcaatctatgtgaaggctataaccctg
accatgttggagaaccgtcatatccatggtgccaagagcaagatcatatatatgcgtaca
gatgcagcagttccttccatcccacaggatatgatctcagcatccaactcatcttctcag
ctggtagtgaagtggaacccacccagtctcccaaatgggaatctctcctattatattgtg
cgatggcagcagcagcctcaggacagacacttgtatcaatacaactattgcttcaaagat
aaagtacccaatcggaaatatgccaatgggaccattgacacagaaggtgggacagagcct
acaaagccagaaggcagtgtaggagaaaagggccattattgtgcctgtcctaaaactgag
gcagaggaaaaagctgaaaaagatgaagcggaatacagaaaagtttttgaaaatttcctc
cacaattccatttttgtgccaaggcccaaccgtaggcgtagagatgtcttagctgttgga
aattccacagtgaccagttatgaaaagaattccaccacagaggacttctccaatttctct
gactctgaaagagatgatatagaatacccattctatgagacaaaggttgactacaagtgg
gagaggacagtgatttcaaacttgcaaccatttactctctatcgtatcgatatccatagc
tgtaaccacgaggctgagaagcttggctgtagtgcatccaattttgtctttgccagaacc
atgccagcagccggagccgatgatatcccaggtatagtaaacactaaagaagaagatgat
ggtgtgatctttctcggatggcctgaacccttaagaccaaatggcctaatactcatgtat
gagattgagtacaagcatcagggagaggtacacagggaatgtgtgtctaggcaggactac
cggaagaacggtggcatcaaactcgtgcggcttcctccaggcaattactcggcacaggtt
caggccatctcactctatggaaatggatcatggacagaaatggtctccttctgtgtaaag
ctaaaaccggatgtgagaaataatatcctgcaaatggtcgtggccattcccctcgccctc
tccttcctgttggtgggtatcatcagcatcgtctgcttcgtttttaagaagagaaacagc
aaccgacttggaaatggtgttctctatgcttctgtgaacccggagtatttcagtgcagca
gaaatgtatgttcctgataaatgggaggttcctcgagagaagataacaatgaacagagag
cttgggcaaggttcgtttggaatggtgtacgagggaattgccaaaggggtggtgaaggat
gaggcagagacgaaagttgccataaagacggtcaacgaagctgccagcatgcgggagaga
attgaatttctgaatgaagcttccgtcatgaaggagttcaactgtcaccacgtggtgcgc
ttattaggggtcgtttctcaaggtcagccaacacttgtcatcatggaattaatgactcga
ggagacctcaaaagctacctacgatctttaagaccagacacagagagtaactccgggcag
cctactccttccctgaagaagatgatccagatggcaggagaaattgcagatggaatgtcc
tatctcaatgcaaacaagtttgttcacagagatctggctgctaggaactgcatggttact
gaggatttcacagttaagattggagactttggcatgacgagagacatctatgagacagac
tattacaggaaaggggggaaaggtctcctgcctgtgcgttggatgtctccggaatccctg
aaggatggtgttttcacaactaactctgatgtctggtcctttggcgttgtgttatgggag
attgcaactctggcagagcagccttaccaaggcatgtccaatgagcaggttcttcgcttt
gttatggaaggaggccttctggagaagccggataactgccctgacatgctgtttgaacta
atgcgcatgtgctggcagttcaaccccaagatgagaccatcgttcctggagattatcagc
agtatcaaagatgaacttgaccccggcttcaaagaggtgtcctttttctacagcgaagag
aacaagcccccagacacagaagagctagatctggaggcagagaacatggagagcattccg
ttggatccctcgtgtgccctgcagaactccgagcaccatgcgggacacaaatctgaaaat
ggcccaggtgtagtagttcttagggcaagttttgatgagaggcaaccatatgcacacatg
aatggagggcgcaaaaatgagagggcactccctctgccccagtcctcggcctgctga

DBGET integrated database retrieval system