KEGG   Xenopus laevis (African clawed frog): 398022Help
Entry
398022            CDS       T01010                                 

Gene name
igf1r, igf-1r, xigf1r
Definition
insulin-like growth factor 1 receptor (EC:2.7.10.1)
Orthology
K05087  
insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
FoxO signaling pathway
Oocyte meiosis
Endocytosis
Focal adhesion
Adherens junction
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    398022 (igf1r)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    398022 (igf1r)
  Cell growth and death
   04114 Oocyte meiosis
    398022 (igf1r)
  Cellular commiunity
   04510 Focal adhesion
    398022 (igf1r)
   04520 Adherens junction
    398022 (igf1r)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    398022 (igf1r)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     398022 (igf1r)
Protein kinases [BR:xla01001]
 Tyrosine protein kinases
  InsR family [OT]
   398022 (igf1r)
Enzyme-linked receptors [BR:xla01020]
 Receptor tyrosine kinases
  RTK class II (Insulin receptor family)
   398022 (igf1r)
Cytokine receptors [BR:xla04050]
 Receptor tyrosine kinase
  RTK class II (Insulin receptor family)
   398022 (igf1r)
Cellular antigens [BR:xla04090]
 Proteins
  398022 (igf1r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 1358 aa AA seqDB search
MKAELVPVCTAWILGLLLCLGPAAAKVCGPNMDIRNDVSELKQLRDCVVIEGYLQILLIS
NAKAEDFRNLRFPNLTVITDYLLLFRVSGLVSLSNLFPNLTVIRGRVLFYNYALVIFEMT
DLKEIGLYNLRNITRGAVRIEKNSELCYVSTVDWSLVLDAVYNNYIVGNKPPKECVDLCP
GAREKMQICEKSSINNEFADRCWSDEHCQKVCPSVCGKRACSDNNECCHPECLGSCTAPD
NDTACVACHHYFYEGRCVPTCPSNTYKFEGWRCITREVCAKMHIWIHSTIPFIIHKGECV
YECPSGYMLNKSQSMTCSPCEGPCPKICEEKMKTIDSVTSAQMLEGCTVLKGNLQLNIRK
GQNIAAELENFLGLIETVTGYVKIRHSHALVSLSFLKSLRYILGEEQMPGNYSFYVFDNN
NLQQLWDWSKHNLTIKEGKIRFAFNSKLCASEIYRMEEVTGTKGRQAEEDISLSTNGNMA
SCESHVLNFTSRSKIKNRIKLTWERYRPPDYRDLISFTVYYKEAPFRNVTEYDGQDACGS
NSWNMVDVDLPASKESDPGILLQGLKPWTQYAIYVKAITLTMLENRHIHGAKSKIIYMRT
DAAVPSIPQDMISASNSSSQLVVKWNPPSLPNGNLSYYIVRWQQQPQDRHLYQYNYCFKD
KVPNRKYANGTIDTEGGTEPTKPEGSVGEKGHYCACPKTEAEEKAEKDEAEYRKVFENFL
HNSIFVPRPNRRRRDVLAVGNSTVTSYEKNSTTEDFSNFSDSERDDIEYPFYETKVDYKW
ERTVISNLQPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAAGADDIPGIVNTKEEDD
GVIFLGWPEPLRPNGLILMYEIEYKHQGEVHRECVSRQDYRKNGGIKLVRLPPGNYSAQV
QAISLYGNGSWTEMVSFCVKLKPDVRNNILQMVVAIPLALSFLLVGIISIVCFVFKKRNS
NRLGNGVLYASVNPEYFSAAEMYVPDKWEVPREKITMNRELGQGSFGMVYEGIAKGVVKD
EAETKVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTR
GDLKSYLRSLRPDTESNSGQPTPSLKKMIQMAGEIADGMSYLNANKFVHRDLAARNCMVT
EDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWE
IATLAEQPYQGMSNEQVLRFVMEGGLLEKPDNCPDMLFELMRMCWQFNPKMRPSFLEIIS
SIKDELDPGFKEVSFFYSEENKPPDTEELDLEAENMESIPLDPSCALQNSEHHAGHKSEN
GPGVVVLRASFDERQPYAHMNGGRKNERALPLPQSSAC
NT seq 4077 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgaattggtgcctgtttgtacggcctggatcctggggctcctcctgtgtctg
ggaccagcggctgccaaagtgtgtggtcccaacatggacatccgaaatgacgtcagtgag
cttaaacagctgagagattgtgtcgtgatcgaaggctacctgcaaattctgctcatctca
aatgccaaggcagaggacttccggaaccttcggttccccaatttgaccgttatcactgac
tatttattgcttttccgggtttctggcttggtgagtctcagcaatctctttcccaacctc
actgtgatccgtggccgagtcctcttctacaactacgcccttgttatctttgagatgacc
gacctcaaggagattggattgtacaacttgcgtaacataacacgtggcgccgtcaggatc
gagaagaactcggaactgtgttatgtgtccacggtggactggtcgcttgttctggatgcc
gtctacaacaactacattgttgggaataagccaccgaaggagtgtgtggatttgtgtcct
ggagctagagagaaaatgcaaatttgtgaaaagtcatccataaataatgaatttgccgac
cgatgttggtcggatgagcactgccaaaaagtctgtcccagtgtttgtggcaagcgagcg
tgttctgataacaacgaatgctgtcatccagaatgcttgggcagctgcacggctcccgat
aacgatacagcttgtgtggcctgtcaccactacttctacgagggccgctgtgtcccgacc
tgcccgtctaacacctataaatttgaagggtggcgctgcatcactcgggaagtatgtgcc
aagatgcatatctggatacacagcacaattccattcatcattcacaaaggagaatgtgta
tacgagtgcccatcaggatacatgctgaataaaagccagagcatgacctgcagcccctgc
gagggtccctgccccaaaatatgtgaagagaagatgaaaaccattgattctgttacctca
gcccaaatgctggaaggttgtactgtcctgaagggcaacctgcaactaaatatccgcaag
ggtcaaaatattgctgcagagttggagaatttcttgggtctgatagagacagtcactggc
tatgtcaagattcgtcactcccatgcactggtatctctgtctttcctgaaaagtctgcgc
tacatcctgggagaggagcaaatgcctggaaattattccttttacgtctttgacaataac
aacttacagcagctgtgggactggtcgaagcacaacctcaccatcaaagagggcaaaata
cgctttgcattcaactccaagctatgcgcttctgagatttaccgcatggaggaagtcacc
ggaacaaaggggaggcaggctgaagaagacatcagcctcagtactaatggaaatatggca
tcttgtgagagtcatgtcttaaatttcacctccaggagcaaaattaagaaccggattaag
cttacttgggagcgttacaggccacctgattacagagaccttatcagcttcactgtctac
tacaaagaggcaccattccgtaatgtaacagagtatgatggtcaggatgcatgcggatcc
aacagctggaatatggtggacgtagacctcccggctagcaaggaaagtgaccctggaatc
ctcctgcagggacttaagccttggacacaatatgcaatctatgtgaaggctataaccctg
accatgttggagaaccgtcatatccatggtgccaagagcaagatcatatatatgcgtaca
gatgcagcagttccttccatcccacaggatatgatctcagcatccaactcatcttctcag
ctggtagtgaagtggaacccacccagtctcccaaatgggaatctctcctattatattgtg
cgatggcagcagcagcctcaggacagacacttgtatcaatacaactattgcttcaaagat
aaagtacccaatcggaaatatgccaatgggaccattgacacagaaggtgggacagagcct
acaaagccagaaggcagtgtaggagaaaagggccattattgtgcctgtcctaaaactgag
gcagaggaaaaagctgaaaaagatgaagcggaatacagaaaagtttttgaaaatttcctc
cacaattccatttttgtgccaaggcccaaccgtaggcgtagagatgtcttagctgttgga
aattccacagtgaccagttatgaaaagaattccaccacagaggacttctccaatttctct
gactctgaaagagatgatatagaatacccattctatgagacaaaggttgactacaagtgg
gagaggacagtgatttcaaacttgcaaccatttactctctatcgtatcgatatccatagc
tgtaaccacgaggctgagaagcttggctgtagtgcatccaattttgtctttgccagaacc
atgccagcagccggagccgatgatatcccaggtatagtaaacactaaagaagaagatgat
ggtgtgatctttctcggatggcctgaacccttaagaccaaatggcctaatactcatgtat
gagattgagtacaagcatcagggagaggtacacagggaatgtgtgtctaggcaggactac
cggaagaacggtggcatcaaactcgtgcggcttcctccaggcaattactcggcacaggtt
caggccatctcactctatggaaatggatcatggacagaaatggtctccttctgtgtaaag
ctaaaaccggatgtgagaaataatatcctgcaaatggtcgtggccattcccctcgccctc
tccttcctgttggtgggtatcatcagcatcgtctgcttcgtttttaagaagagaaacagc
aaccgacttggaaatggtgttctctatgcttctgtgaacccggagtatttcagtgcagca
gaaatgtatgttcctgataaatgggaggttcctcgagagaagataacaatgaacagagag
cttgggcaaggttcgtttggaatggtgtacgagggaattgccaaaggggtggtgaaggat
gaggcagagacgaaagttgccataaagacggtcaacgaagctgccagcatgcgggagaga
attgaatttctgaatgaagcttccgtcatgaaggagttcaactgtcaccacgtggtgcgc
ttattaggggtcgtttctcaaggtcagccaacacttgtcatcatggaattaatgactcga
ggagacctcaaaagctacctacgatctttaagaccagacacagagagtaactccgggcag
cctactccttccctgaagaagatgatccagatggcaggagaaattgcagatggaatgtcc
tatctcaatgcaaacaagtttgttcacagagatctggctgctaggaactgcatggttact
gaggatttcacagttaagattggagactttggcatgacgagagacatctatgagacagac
tattacaggaaaggggggaaaggtctcctgcctgtgcgttggatgtctccggaatccctg
aaggatggtgttttcacaactaactctgatgtctggtcctttggcgttgtgttatgggag
attgcaactctggcagagcagccttaccaaggcatgtccaatgagcaggttcttcgcttt
gttatggaaggaggccttctggagaagccggataactgccctgacatgctgtttgaacta
atgcgcatgtgctggcagttcaaccccaagatgagaccatcgttcctggagattatcagc
agtatcaaagatgaacttgaccccggcttcaaagaggtgtcctttttctacagcgaagag
aacaagcccccagacacagaagagctagatctggaggcagagaacatggagagcattccg
ttggatccctcgtgtgccctgcagaactccgagcaccatgcgggacacaaatctgaaaat
ggcccaggtgtagtagttcttagggcaagttttgatgagaggcaaccatatgcacacatg
aatggagggcgcaaaaatgagagggcactccctctgccccagtcctcggcctgctga

DBGET integrated database retrieval system