KEGG   Xenopus laevis (African clawed frog): 398115Help
Entry
398115            CDS       T01010                                 

Gene name
cast.S, calp3, cast, xcalp3
Definition
(RefSeq) calpastatin S homeolog
  KO
K04281  
calpastatin
Organism
xla  Xenopus laevis (African clawed frog)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
AA seq 931 aa AA seqDB search
MQACRQEAIRRIREKPAAGVSGNAGAQASGSSKTPAPSGKTMNPVDTQPKGATAGPAAAT
KPTAAPSAALAKTTAAPSAVPAAATKPTAAPSTAPVAVTKPTEIKPSAGKSPPKQDTKPT
PGKQKPDSKSKEEKKSDDKATAPVQPPKVTPSSAGKVSAVATGFVAAAGATAAVTAVQST
KQKDESKEEKKAVIGDKVSSAASPAKTGADTALDELLDTLGSPADIPESPKFTGPEIQDT
VVTSKYVEELGKRDHTIPPNYRKLLDGKGEKMAPPTPPLVAEASMDDDDLVAALSSGFKS
SQTCPEVKKPLEEKLEEKPKSAATVATQPDLQKKDVKATAAETSKASIQKKEVKATAAEA
SKQSTQAIPSDAVDELLGTLEGPPANVPESPVFEGPEVAETIKSTYLEELGKRDHTIPPE
YRNLLDGKDHEKAVQPSAPVEPEPTMTDADLVDEFSKDFELSCSPTVQTTPAVKPKGTPQ
GNKAKPEVVVASSTSTVKAAAAPSAGMDSALDDLLGTLEGPDLTVPESPVYSGPEVTETS
TAVYREELGKRDDSIPPAYRHLLDGKEDGKVAPPPPPEEEPLTDDQLLDEFSMDFSCSKS
PAKEQAQPVEPKVSSKEKKAEAEVVAASSAAVKAAPAPYKAAAQAPSADPLDALAGTLGV
RKEDPSDKKPAVDKVKEGTPGKEKKEKLGEDERTIPPDRRLKEVKDKDGKPLLPKPEESP
KPMSEADLLDALTEGFVTSPATPAAPLQSSLKKGPGSEDVVSCSKASAVKSGAPQPAASD
IEIPEDALDLLAGSLGQREVDPDENKPVVDVVKEKAKAEHIDRLGDRDDTIPPEYRKLLD
GKDDKGQAAKPPVKEEEKPKKPLSDDAAIDALSSGFASCDTKSTEKPKHPSTDKTEKQSA
SAPVSQTSGKATDAAKQENATKPIVPKAGKT
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcctgcagacaagaagccatcagaaggatcagagaaaaacctgctgccggtgtc
agtggtaatgcaggggcccaagcaagtggaagcagcaagactccagctccttcaggaaaa
actatgaacccagtggatacacagccaaaaggagcaacagcaggcccagcagcagcaacc
aaaccaacagcagcaccttcagcagcattagccaaaacaacagcagcaccttcagcagtg
ccagcagcagcaaccaaaccaacagcagcgccttccacagccccagtagcagtgaccaaa
ccaacagaaataaagccaagtgcagggaaatcacctcccaaacaagacacaaagcctacc
cctggaaagcagaaaccagacagcaagagtaaagaggaaaagaaaagtgatgataaagct
acagcacccgtgcaaccacctaaggttaccccaagttctgctggtaaagtatctgctgtt
gccactggatttgtagcagctgctggtgcgaccgctgcagtcactgctgtacaatcaaca
aagcagaaagatgagagtaaagaggaaaagaaagccgttattggggataaagtatcttca
gctgcatcaccagccaagacaggcgcagatacagctttggatgaactgcttgacacatta
ggaagcccagcagatattccagagtctccaaagttcactggacccgaaatccaggacaca
gttgttacatctaagtatgtagaggaactgggaaaaagggatcacaccatcccacctaat
tataggaaactgctggatggaaaaggtgaaaagatggcaccacctaccccacccctggta
gccgaagcgagcatggatgatgatgacttagttgcagccctgtcttctggtttcaagagc
agccaaacatgccccgaggtaaagaaaccactagaagagaaactggaagagaaaccaaaa
tcagcagcaacagtggcaacacagccagatttacagaaaaaagatgtaaaagccactgca
gcagaaacttccaaagcaagcatccagaaaaaagaggtaaaagccacagctgcagaagct
tccaaacaaagtacccaggccataccatcagatgcggtagatgaattgttgggaacacta
gagggacccccagcaaatgttccagaatctcctgtgtttgagggtccagaagttgctgag
accattaaatcaacatacttggaagaacttggaaaaagagatcatacaatccctccagaa
tacagaaacttattagatgggaaggatcatgagaaagctgtacagccttcagcaccagtt
gaaccagaaccgaccatgaccgacgcagaccttgtagacgagttttccaaagactttgag
ctttcatgttctcctactgttcagaccacgccggcagtcaaacccaaaggaactcctcaa
ggtaacaaagcaaaacctgaagttgttgtggcgtcctccacgtctacagtaaaagcagcg
gcagcaccctctgctggcatggacagtgcattagatgatttattgggaacactggaaggt
cctgatctaacagtcccagaatcgcctgtgtactctggaccagaagtgaccgaaaccagc
acagcagtatatcgagaggaacttgggaagagagacgacagcatccctccagcatacagg
cacttgctagatggcaaagaagatggaaaagttgcacccccgccaccaccagaggaagag
cccctgactgatgatcagcttcttgatgagttttctatggacttttcctgttctaaatcc
cctgcaaaagaacaagctcagcccgtcgaacctaaagtttcctcgaaagaaaaaaaggca
gaagctgaagttgtcgctgcctcctctgctgctgttaaagctgcacccgctccctataaa
gccgccgcacaagcaccttcagctgatccactcgatgccctggctggtaccttaggtgtt
cgaaaggaagaccccagtgacaagaagcctgcagtggataaagtaaaggagggaacgcca
ggtaaagagaaaaaggaaaagcttggagaagatgaaagaacaatacctcctgaccgccgg
ctaaaggaagtgaaggataaagacggaaagcccttgctgccaaaaccagaagaaagccct
aagccaatgagtgaggccgacctgctcgatgctttgaccgaaggctttgtcacttctcct
gccacccctgctgcaccattgcagtcctctctgaaaaagggccctggatcagaagatgtt
gtatcttgttctaaagcttccgccgtcaagtctggagctccacagcctgctgcttcagac
atagagattcccgaagatgcactagatttacttgctggctcccttggacagagagaggtg
gatccagatgaaaacaaacccgtagtggatgtagttaaggaaaaagccaaagctgagcat
atagacagactgggggacagagatgacacaatcccaccggaatacagaaagctgctggat
ggtaaagatgataagggtcaggctgcaaaaccaccagtgaaagaggaggagaaacccaag
aagcctttaagtgacgatgcagcaatagatgctctttcgagtggatttgcatcatgtgac
acaaaatctactgaaaaaccaaagcacccttcaacggacaagaccgagaaacaatctgct
agtgctccagtgtcacagacttcaggaaaggcaactgatgctgcaaagcaggaaaatgca
acaaaaccaattgtgccaaaggctggtaaaacctaa

DBGET integrated database retrieval system