KEGG   Xenopus laevis (African clawed frog): 398141Help
Entry
398141            CDS       T01010                                 

Definition
tyrosine phosphatase Cdc25A
Orthology
K06645  
M-phase inducer phosphatase 1 [EC:3.1.3.48]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Progesterone-mediated oocyte maturation
Module
DNA damage-induced cell cycle checkpoints
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    398141
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    398141
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     398141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 525 aa AA seqDB search
MERFRSAPAHVRGSSRLSGLPVVKSLFSCEADTALSPVTSLALNMDQLAGLGSQCETPTR
KLEDRWSMQRTDSSESMDAGLCLDSPIKMDLRDTEETFQKTTPDRVRVGHTRLPIGRRNS
LPQNLLGSSPAFKRNLSYSLECEVFHLADLENKENETFQFKIPARPRSRGCFRSRLHGDG
KEGLVQRQKSAPACMLSSPRKTEVAASDMVFVRKSSTASTSTEGSDDGFLDMLDGEDLEN
DLEFPCGVASLWTAPLVMKSTENFVEARAEPNCTTKPVLKRVERPLDEDTPEKSKRRKSM
SEIVNEGLDHDKNTRYMRSKSFSSQSIETILDNDQVDLIGDFSKVFLFPTVSGRHQELKY
ITPEMMVLILNGRFDPFIERFVVIDCRYPYEYQGGHIQGAINLHMEQEAEEYFLKNPISS
STCKRVILIFHCEFSSERGPRMCKFLREKDRDRNEYPQLHYPELYILHGGYKEFFQKCKT
YCTPQSYRPMNHEDFKEDLRKFRMKSRTWAGERSKRELYSRLKKL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggagaggtttcgttctgctccggctcatgtccgaggatccagccgcctctccggcctc
cctgtggtcaagtccctgttctcttgcgaggccgacactgcgctgtctccggtcaccagc
ctcgctctcaatatggaccaactggccggcctgggcagccagtgtgaaacacctacacgt
aagctggaagatcgctggtccatgcaaagaacagactcttcagaatcaatggacgccggt
ctctgcctggattctccaattaagatggatctaagagacacagaagaaacgtttcaaaaa
acgactcctgatcgtgtcagggttggacacacaaggttaccgattggaaggaggaattcc
ctgccgcaaaacttactgggatccagccctgcctttaagaggaatctttcttactctctg
gaatgtgaagttttccacctggccgacctggagaacaaggagaatgaaacctttcagttt
aaaatccctgcaagaccacgttcccggggctgtttccgctcaagactccacggagatggg
aaggaaggtctcgttcaaagacagaaatctgcacctgcctgtatgttatcttctcccaga
aaaactgaagttgctgcttctgatatggtctttgtcagaaaatcctccactgcttccacg
tccactgaaggaagcgacgatggcttcttggatatgttggacggagaggacctagagaac
gacctggagtttccgtgtggtgtggcaagcctatggacagctccccttgttatgaaaagc
actgaaaactttgtggaagccagggctgagccaaactgcactacaaaaccagtactaaaa
cgcgtggagcgaccactagacgaagacacgccagaaaaaagcaaaagacgaaagagcatg
tctgaaatagttaatgaaggacttgatcatgacaaaaacacaaggtacatgagatcaaaa
tccttttcgagtcagagcatagaaactatactggacaacgatcaagtcgatctcatcggg
gacttttcaaaggtcttcctgtttcctacagtaagcggcaggcaccaggaactgaagtat
atcacacctgaaatgatggttctgatcctaaatggcaggtttgatcctttcattgagcgc
tttgtggttattgattgcagatacccttacgagtatcaaggaggccacatacagggagcc
attaaccttcacatggagcaagaggctgaggaatatttcctaaagaatccaatctcgtcg
tccacttgcaagcgagtcattttaatcttccactgtgagttctcatcagagcggggaccc
agaatgtgcaagtttctaagggagaaagacagagaccgaaatgaatatccgcagttacac
tatccagagctttatattttacatggtggatataaagaatttttccagaaatgcaagacc
tactgtaccccgcagagctaccgccccatgaaccacgaggactttaaagaagacttgaga
aagttccgcatgaagagccggacatgggcgggggagagaagcaaaagagaactgtacagc
cggctgaagaaactatga

DBGET integrated database retrieval system