KEGG   Xenopus laevis (African clawed frog): 398152Help
Entry
398152            CDS       T01010                                 

Gene name
spdyc-b, ls27, ringo2, spdy1, spdya-B, spdyc, spy1
Definition
speedy/RINGO cell cycle regulator family member C
Orthology
K08694  
speedy
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Oocyte meiosis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    398152 (spdyc-b)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    398152 (spdyc-b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 298 aa AA seqDB search
MRHMQSATRATLVCGSGVKQIIAKGHPNTRVFGARKAKIPEREVLAAKPKITRITHLNLQ
PQERQAFYRLLENELIQEFLSMDSCLKISDKYLIAMVLAYFKRAGLYTSEYTTMNFFVAL
YLANDMEEDEEDYKYEIFPWALGDSWREFFPQFLRLRDDFWAKMNYRAVVSRRCCDEVMA
KDPTHWAWLRDRPIHHSGALRGYLRNEDDFFPRGPGLTPASCALCHKASVCDSGGVSHDN
SSPEQEIFHYTNREWSQELLILPPELLLDPESTYDIHIFQEPLVGLEPDGAALEWHHL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaggcatatgcagagtgcaacccgggccaccttagtttgtggcagcggggtaaagcag
atcattgccaagggacatccgaatacccgggtttttggagcgcgcaaggcgaaaatccct
gagagagaggtgctagcagccaaacccaagatcacgcgcattacacatctcaatctacaa
ccccaggagcgccaggccttttacaggctcctagaaaatgagctgattcaggaatttctt
tctatggactcctgtctaaagatttcagacaagtatctcatagcaatggttctagcatat
tttaagcgggcgggcctctacaccagcgagtacacaaccatgaatttctttgttgctctg
tatctggctaatgacatggaggaagatgaagaagactataaatatgaaatcttcccctgg
gcactaggagattcatggcgtgagtttttcccacaatttttacgtctccgggacgacttc
tgggctaaaatgaactaccgagcagttgttagccgaagatgttgtgatgaggtaatggcg
aaagatcccactcattgggcctggctcagagatcgtcctattcatcatagtggggccctg
cgtggttacctcagaaatgaggatgactttttccctcggggtccaggccttacaccagcc
agctgtgcactttgccataaagcaagtgtctgtgactctggtggggtgtcccatgacaac
tcttctccagaacaagagatttttcactacaccaatagggagtggtcccaggaacttctc
atcttgccacctgaactgttattggatccggagtctacttatgacatccacattttccag
gaaccgttggttggattagagccagatggggcagccttggaatggcaccacctttag

DBGET integrated database retrieval system