KEGG   Xenopus laevis (African clawed frog): 398162Help
Entry
398162            CDS       T01010                                 

Definition
cyclin B5
Orthology
K05868  
cyclin B
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
FoxO signaling pathway
Cell cycle
Oocyte meiosis
p53 signaling pathway
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    398162
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    398162
   04114 Oocyte meiosis
    398162
   04115 p53 signaling pathway
    398162
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    398162
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 390 aa AA seqDB search
MATWAAMRTGQMDNAVVGGVVAAKVKVHGHRPPLEEISNRTAILGRKPAAMNCKVPVKVV
RQVTSRANLPLRVKQAFGPKSEEPPPIPMDVADNEEVLCQAFSEALNSVEDIDAEDSSNP
QLCADYVKDIYSYLRQLEVQQAVRPRHLQGMEINDRMRAILVDWLIQVHLKFQLLQETLY
MAIAIMDRFLQGQPISRSKLQLVGVTSLFIASKYEEMYYPEISDFVYITDNTYSKTQIRE
MEMMILKEINFDLGRPLPLNFLRRASKCCSADAGQHTLAKYFMELTLLDYDMVHFHPSAI
AAAALCLTQKVLNMGTWDAALQFYTGYSQDDLSLPMKHMAKNIVQVNQNLSKFLSVKNKY
SSSKLLKISTIPQLNSRVLTGLAAAVTPGS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggctacttgggctgctatgcgtacaggacagatggacaatgcagtcgtgggtggagtg
gtggcagccaaagtgaaagtacatggacatagacccccactagaagaaatcagtaacagg
actgcaattctaggacgcaaacctgcagcgatgaactgcaaggtgcctgtcaaagtggtc
agacaagtaacctccagagcaaatctgcctttaagagttaaacaggcatttggccccaaa
tctgaggaacctcctcccatacctatggatgtagctgataacgaggaggtgttgtgtcaa
gctttctctgaagctttgaacagtgttgaggatattgatgcagaggattcttcaaaccct
cagttatgcgcggattatgtgaaggacatctattcctatttaaggcagttagaggttcaa
caggctgtacgcccaagacacctacagggaatggagatcaatgatcggatgagagccatt
ctagtcgactggttaatacaagtccacttaaaatttcaactacttcaagagacattatat
atggcaatagcaattatggaccgttttctacagggtcagcctatctcccgaagcaagcta
cagttggttggtgtcacctcgctcttcatagcttcaaagtatgaagaaatgtattatcca
gagatttctgactttgtttacatcactgacaacacctactccaaaactcaaattagagaa
atggaaatgatgattctcaaggagattaactttgatctaggaagaccgctgccccttaat
ttccttagaagagcttcaaaatgttgcagtgctgatgcaggacagcacacacttgccaag
tacttcatggagttgactctacttgactatgacatggttcacttccatccttcagcaatt
gctgctgctgctttgtgcctgacccaaaaggttcttaatatgggcacatgggatgctgct
ctacagttttacacaggctattcacaagatgatcttagcctgcctatgaagcatatggcc
aagaacatcgttcaggtcaaccaaaacctgtcaaaatttttatctgtgaagaataaatat
tctagtagtaaattactgaagatcagcacaatccctcaactgaactcgcgtgttttaact
ggtcttgctgctgctgtaacgccaggctcgtag

DBGET integrated database retrieval system