KEGG   Xenopus laevis (African clawed frog): 398162Help
Entry
398162            CDS       T01010                                 

Definition
cyclin B5
Orthology
K05868  
cyclin B
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
FoxO signaling pathway
Cell cycle
Oocyte meiosis
p53 signaling pathway
Progesterone-mediated oocyte maturation
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:xla04068]
Cellular Processes; Cell growth and death; Cell cycle [PATH:xla04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:xla04114]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:xla04115]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xla04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 390 aa AA seqDB search
MATWAAMRTGQMDNAVVGGVVAAKVKVHGHRPPLEEISNRTAILGRKPAAMNCKVPVKVV
RQVTSRANLPLRVKQAFGPKSEEPPPIPMDVADNEEVLCQAFSEALNSVEDIDAEDSSNP
QLCADYVKDIYSYLRQLEVQQAVRPRHLQGMEINDRMRAILVDWLIQVHLKFQLLQETLY
MAIAIMDRFLQGQPISRSKLQLVGVTSLFIASKYEEMYYPEISDFVYITDNTYSKTQIRE
MEMMILKEINFDLGRPLPLNFLRRASKCCSADAGQHTLAKYFMELTLLDYDMVHFHPSAI
AAAALCLTQKVLNMGTWDAALQFYTGYSQDDLSLPMKHMAKNIVQVNQNLSKFLSVKNKY
SSSKLLKISTIPQLNSRVLTGLAAAVTPGS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggctacttgggctgctatgcgtacaggacagatggacaatgcagtcgtgggtggagtg
gtggcagccaaagtgaaagtacatggacatagacccccactagaagaaatcagtaacagg
actgcaattctaggacgcaaacctgcagcgatgaactgcaaggtgcctgtcaaagtggtc
agacaagtaacctccagagcaaatctgcctttaagagttaaacaggcatttggccccaaa
tctgaggaacctcctcccatacctatggatgtagctgataacgaggaggtgttgtgtcaa
gctttctctgaagctttgaacagtgttgaggatattgatgcagaggattcttcaaaccct
cagttatgcgcggattatgtgaaggacatctattcctatttaaggcagttagaggttcaa
caggctgtacgcccaagacacctacagggaatggagatcaatgatcggatgagagccatt
ctagtcgactggttaatacaagtccacttaaaatttcaactacttcaagagacattatat
atggcaatagcaattatggaccgttttctacagggtcagcctatctcccgaagcaagcta
cagttggttggtgtcacctcgctcttcatagcttcaaagtatgaagaaatgtattatcca
gagatttctgactttgtttacatcactgacaacacctactccaaaactcaaattagagaa
atggaaatgatgattctcaaggagattaactttgatctaggaagaccgctgccccttaat
ttccttagaagagcttcaaaatgttgcagtgctgatgcaggacagcacacacttgccaag
tacttcatggagttgactctacttgactatgacatggttcacttccatccttcagcaatt
gctgctgctgctttgtgcctgacccaaaaggttcttaatatgggcacatgggatgctgct
ctacagttttacacaggctattcacaagatgatcttagcctgcctatgaagcatatggcc
aagaacatcgttcaggtcaaccaaaacctgtcaaaatttttatctgtgaagaataaatat
tctagtagtaaattactgaagatcagcacaatccctcaactgaactcgcgtgttttaact
ggtcttgctgctgctgtaacgccaggctcgtag

DBGET integrated database retrieval system